PDB entry 1rci

View 1rci on RCSB PDB site
Description: bullfrog red cell l ferritin tartrate/mg/ph 5.5
Deposited on 1995-08-04, released 1995-11-14
The last revision prior to the SCOP 1.59 freeze date was dated 1995-11-14, with a file datestamp of 1995-11-15.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.186
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1rci__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rci_ (-)
    sqvrqnfhqdceaglnrtvnlkfyssyvylsmasyfnrddvalsnfakffrerseeekeh
    aeklieyqnqrggrvflqsvekperddwanglealqtalklqksvnqalldlhavaadks
    dphmtdflespylsesvetikklgdhitslkklwsshpgmaeylfnkhtlg