PDB entry 1rce

View 1rce on RCSB PDB site
Description: bullfrog red cell l ferritin sulfate/mn/ph 6.3
Class: iron storage
Keywords: iron storage
Deposited on 1995-08-04, released 1995-11-14
The last revision prior to the SCOP 1.73 freeze date was dated 1995-11-14, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.187
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l ferritin
    Species: Rana catesbeiana
    Gene: CDNA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07797 (Start-172)
      • engineered (56-58)
      • engineered (60)
    Domains in SCOP 1.73: d1rcea_
  • Heterogens: BET, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rceA (A:)
    mesqvrqnfhqdceaglnrtvnlkfhssyvylsmasyfnrddvalsnfakffrersaaak
    ahaeklieyqnqrggrvflqsvekperddwanglealqtalklqksvnqalldlhavaad
    ksdphmtdflespylsesvetikklgdhitslkklwsshpgmaeylfnkhtlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rceA (A:)
    sqvrqnfhqdceaglnrtvnlkfhssyvylsmasyfnrddvalsnfakffrersaaakah
    aeklieyqnqrggrvflqsvekperddwanglealqtalklqksvnqalldlhavaadks
    dphmtdflespylsesvetikklgdhitslkklwsshpgmaeylfnkhtlg