PDB entry 1rcd

View 1rcd on RCSB PDB site
Description: bullfrog red cell l ferritin tartrate/mg/ph 5.5
Class: iron storage
Keywords: iron storage
Deposited on 1995-08-04, released 1995-11-14
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.186
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l ferritin
    Species: Rana catesbeiana [TaxId:8400]
    Gene: CDNA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1rcda_
  • Heterogens: BET, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rcdA (A:)
    mesqvrqnfhqdceaglnrtvnlkfhssyvylsmasyfnrddvalsnfakffrerseeek
    ehaeklieyqnqrggrvflqsvekperddwanglealqtalklqksvnqalldlhavaad
    ksdphmtdflespylsesvetikklgdhitslkklwsshpgmaeylfnkhtlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rcdA (A:)
    sqvrqnfhqdceaglnrtvnlkfhssyvylsmasyfnrddvalsnfakffrerseeekeh
    aeklieyqnqrggrvflqsvekperddwanglealqtalklqksvnqalldlhavaadks
    dphmtdflespylsesvetikklgdhitslkklwsshpgmaeylfnkhtlg