PDB entry 1rc7

View 1rc7 on RCSB PDB site
Description: Crystal structure of RNase III Mutant E110K from Aquifex Aeolicus complexed with ds-RNA at 2.15 Angstrom Resolution
Class: hydrolase/RNA
Keywords: Ribonuclease III, ds-RNA, RNA interference, Endonucleolytic cleavage, HYDROLASE/RNA COMPLEX
Deposited on 2003-11-03, released 2004-03-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.192
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ribonuclease III
  Species: Aquifex aeolicus [TaxId:63363]
  Gene: RNC, AQ_946
  Database cross-references and differences (RAF-indexed):
  • Uniprot O67082 (0-219)
    • engineered (109)
  Domains in SCOPe 2.08: d1rc7a1, d1rc7a2
• Chain 'B':
  Compound: 5'-r(*gp*gp*cp*gp*cp*gp*cp*gp*cp*c)-3'
  
• Chain 'C':
  Compound: 5'-r(*gp*gp*cp*gp*cp*gp*cp*gp*cp*c)-3'
  
• Chain 'D':
  Compound: 5'-r(*gp*gp*cp*gp*cp*gp*cp*gp*cp*c)-3'
  
• Chain 'E':
  Compound: 5'-r(*gp*gp*cp*gp*cp*gp*cp*gp*cp*c)-3'
  
• Heterogens: TRS, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rc7A (A:)
  mkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqysp
  nkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfkalwaavyids
  grdanftrelfyklfkedilsaikegrvkkdyktilqeitqkrwkerpeyrlisvegphh
  kkkfiveakikeyrtlgegkskkeaeqraaeelikllees
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.