PDB entry 1rbm

View 1rbm on RCSB PDB site
Description: Human GAR Tfase complex structure with polyglutamated 10-(trifluoroacetyl)-5,10-dideazaacyclic-5,6,7,8-tetrahydrofolic acid
Class: transferase
Keywords: protein-cofactor analogue complex
Deposited on 2003-11-03, released 2005-06-14
The last revision prior to the SCOP 1.75 freeze date was dated 2005-06-14, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.237
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoribosylglycinamide formyltransferase
    Species: HOMO SAPIENS
    Gene: PURN
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1rbma1
  • Chain 'B':
    Compound: phosphoribosylglycinamide formyltransferase
    Species: HOMO SAPIENS
    Gene: PURN
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1rbmb1
  • Heterogens: PO4, KT5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rbmA (A:)
    arvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaeragiptrvinhkl
    yknrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihpsllpsfkgsna
    heqaletgvtvtgctvhfvaedvdagqiilqeavpvkrgdtvatlservklaehkifpaa
    lqlvasgtvqlgengkicwvkeehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rbmA (A:)
    arvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaeragiptrvinhkl
    yknrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihpsllpsfkgsna
    heqaletgvtvtgctvhfvaedvdagqiilqeavpvkrgdtvatlservklaehkifpaa
    lqlvasgtvqlgengkicwv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rbmB (B:)
    arvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaeragiptrvinhkl
    yknrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihpsllpsfkgsna
    heqaletgvtvtgctvhfvaedvdagqiilqeavpvkrgdtvatlservklaehkifpaa
    lqlvasgtvqlgengkicwvkeehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rbmB (B:)
    arvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaeragiptrvinhkl
    yknrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihpsllpsfkgsna
    heqaletgvtvtgctvhfvaedvdagqiilqeavpvkrgdtvatlservklaehkifpaa
    lqlvasgtvqlgengkicwv