PDB entry 1rba

View 1rba on RCSB PDB site
Description: substitution of asp193 to asn at the active site of ribulose-1,5- bisphosphate carboxylase results in conformational changes
Deposited on 1991-11-18, released 1994-01-31
The last revision prior to the SCOP 1.59 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.6 Å
R-factor: 0.207
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rbaA (A:)
    sryvnlalkeedliaggehvlcayimkpkagygyvataahfaaesstgtnvevcttddft
    rgvdalvyevdeareltkiaypvalfdrnitdgkamiasfltltmgnnqgmgdveyakmh
    dfyvpeayralfdgpsvnisalwkvlgrpevdgglvvgtiikpklglrpkpfaeachafw
    lggdfiknnepqgnqpfaplrdtialvadamrraqdetgeaklfsanitaddpfeiiarg
    eyvletfgenashvallvdgyvagaaaittarrrfpdnflhyhraghgavtspqskrgyt
    afvhckmarlqgasgihtgtmgfgkmegessdraiaymltqdeaqgpfyrqswggmkact
    piisggmnalrmpgffenlgnanviltagggafghidgpvagarslrqawqawrdgvpvl
    dyarehkelarafesfp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rbaA (A:)
    sryvnlalkeedliaggehvlcayimkpkagygyvataahfaaesstgtnvtrgvdalvy
    evdeareltkiaypvalfdrnitdgkamiasfltltmgnnqgmgdveyakmhdfyvpeay
    ralfdgpsvnisalwkvlgrpevdgglvvgtiikpklglrpkpfaeachafwlggdfikn
    nepqgnqpfaplrdtialvadamrraqdetgeaklfsanitaddpfeiiargeyvletfg
    enashvallvdgyvagaaaittarrrfpdnflhyhraghgavtspqskrgytafvhckma
    rlqgasgihtgtsdraiaymltqdeaqgpfyrqswggmkactpiisggmnalrmpgffen
    lgnanviltagggafghidgpvagarslrqawqawrdgvpvldyarehkelarafesfp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rbaB (B:)
    sryvnlalkeedliaggehvlcayimkpkagygyvataahfaaesstgtnvevcttddft
    rgvdalvyevdeareltkiaypvalfdrnitdgkamiasfltltmgnnqgmgdveyakmh
    dfyvpeayralfdgpsvnisalwkvlgrpevdgglvvgtiikpklglrpkpfaeachafw
    lggdfiknnepqgnqpfaplrdtialvadamrraqdetgeaklfsanitaddpfeiiarg
    eyvletfgenashvallvdgyvagaaaittarrrfpdnflhyhraghgavtspqskrgyt
    afvhckmarlqgasgihtgtmgfgkmegessdraiaymltqdeaqgpfyrqswggmkact
    piisggmnalrmpgffenlgnanviltagggafghidgpvagarslrqawqawrdgvpvl
    dyarehkelarafesfpgdadqiypgwrkalgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rbaB (B:)
    sryvnlalkeedliaggehvlcayimkpkagygyvataahfaaesstgtnvevcttddft
    rgvdalvyevdeareltkiaypvalfdrnitdgkamiasfltltmgnnqgmgdveyakmh
    dfyvpeayralfdgpsvnisalwkvlgrpevdgglvvgtiikpklglrpkpfaeachafw
    lggdfiknnepqgnqpfaplrdtialvadamrraqdetgeaklfsanitaddpfeiiarg
    eyvletfgenashvallvdgyvagaaaittarrrfpdnflhyhraghgavtspqskrgyt
    afvhckmarlqgasgihtgtsdraiaymltqdeaqgpfyrqswggmkactpiisggmnal
    rmpgffenlgnanviltagggafghidgpvagarslrqawqawrdgvpvldyarehkela
    rafesfpgdadqiypgwrkalgv