PDB entry 1rba

View 1rba on RCSB PDB site
Description: substitution of asp193 to asn at the active site of ribulose-1,5-bisphosphate carboxylase results in conformational changes
Class: lyase(carbon-carbon)
Keywords: lyase(carbon-carbon)
Deposited on 1991-11-18, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubisco
    Species: Rhodospirillum rubrum [TaxId:1085]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04718
      • conflict (90)
      • engineered mutation (192)
    Domains in SCOPe 2.07: d1rbaa1, d1rbaa2
  • Chain 'B':
    Compound: rubisco
    Species: Rhodospirillum rubrum [TaxId:1085]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04718
      • conflict (90)
      • engineered mutation (192)
    Domains in SCOPe 2.07: d1rbab1, d1rbab2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rbaA (A:)
    mdqssryvnlalkeedliaggehvlcayimkpkagygyvataahfaaesstgtnvevctt
    ddftrgvdalvyevdeareltkiaypvalfdrnitdgkamiasfltltmgnnqgmgdvey
    akmhdfyvpeayralfdgpsvnisalwkvlgrpevdgglvvgtiikpklglrpkpfaeac
    hafwlggdfiknnepqgnqpfaplrdtialvadamrraqdetgeaklfsanitaddpfei
    iargeyvletfgenashvallvdgyvagaaaittarrrfpdnflhyhraghgavtspqsk
    rgytafvhckmarlqgasgihtgtmgfgkmegessdraiaymltqdeaqgpfyrqswggm
    kactpiisggmnalrmpgffenlgnanviltagggafghidgpvagarslrqawqawrdg
    vpvldyarehkelarafesfpgdadqiypgwrkalgvedtrsalpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rbaA (A:)
    sryvnlalkeedliaggehvlcayimkpkagygyvataahfaaesstgtnvtrgvdalvy
    evdeareltkiaypvalfdrnitdgkamiasfltltmgnnqgmgdveyakmhdfyvpeay
    ralfdgpsvnisalwkvlgrpevdgglvvgtiikpklglrpkpfaeachafwlggdfikn
    nepqgnqpfaplrdtialvadamrraqdetgeaklfsanitaddpfeiiargeyvletfg
    enashvallvdgyvagaaaittarrrfpdnflhyhraghgavtspqskrgytafvhckma
    rlqgasgihtgtsdraiaymltqdeaqgpfyrqswggmkactpiisggmnalrmpgffen
    lgnanviltagggafghidgpvagarslrqawqawrdgvpvldyarehkelarafesfp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rbaB (B:)
    mdqssryvnlalkeedliaggehvlcayimkpkagygyvataahfaaesstgtnvevctt
    ddftrgvdalvyevdeareltkiaypvalfdrnitdgkamiasfltltmgnnqgmgdvey
    akmhdfyvpeayralfdgpsvnisalwkvlgrpevdgglvvgtiikpklglrpkpfaeac
    hafwlggdfiknnepqgnqpfaplrdtialvadamrraqdetgeaklfsanitaddpfei
    iargeyvletfgenashvallvdgyvagaaaittarrrfpdnflhyhraghgavtspqsk
    rgytafvhckmarlqgasgihtgtmgfgkmegessdraiaymltqdeaqgpfyrqswggm
    kactpiisggmnalrmpgffenlgnanviltagggafghidgpvagarslrqawqawrdg
    vpvldyarehkelarafesfpgdadqiypgwrkalgvedtrsalpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rbaB (B:)
    sryvnlalkeedliaggehvlcayimkpkagygyvataahfaaesstgtnvevcttddft
    rgvdalvyevdeareltkiaypvalfdrnitdgkamiasfltltmgnnqgmgdveyakmh
    dfyvpeayralfdgpsvnisalwkvlgrpevdgglvvgtiikpklglrpkpfaeachafw
    lggdfiknnepqgnqpfaplrdtialvadamrraqdetgeaklfsanitaddpfeiiarg
    eyvletfgenashvallvdgyvagaaaittarrrfpdnflhyhraghgavtspqskrgyt
    afvhckmarlqgasgihtgtsdraiaymltqdeaqgpfyrqswggmkactpiisggmnal
    rmpgffenlgnanviltagggafghidgpvagarslrqawqawrdgvpvldyarehkela
    rafesfpgdadqiypgwrkalgv