PDB entry 1rb9

View 1rb9 on RCSB PDB site
Description: rubredoxin from desulfovibrio vulgaris refined anisotropically at 0.92 angstroms resolution
Class: iron-sulfur protein
Keywords: iron-sulfur protein, rubredoxin, atomic resolution, anisotropic refinement
Deposited on 1997-12-21, released 1999-02-16
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 0.92 Å
R-factor: 0.073
AEROSPACI score: 1.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubredoxin
    Species: Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough [TaxId:882]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1rb9a_
  • Heterogens: FE2, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rb9A (A:)
    mkkyvctvcgyeydpaegdpdngvkpgtsfddlpadwvcpvcgapksefeaa