PDB entry 1rb9

View 1rb9 on RCSB PDB site
Description: rubredoxin from desulfovibrio vulgaris refined anisotropically at 0.92 angstroms resolution
Class: iron-sulfur protein
Keywords: iron-sulfur protein, rubredoxin, atomic resolution, anisotropic refinement
Deposited on 1997-12-21, released 1999-02-16
The last revision prior to the SCOP 1.75 freeze date was dated 1999-02-16, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 0.92 Å
R-factor: 0.073
AEROSPACI score: 1.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubredoxin
    Species: Desulfovibrio vulgaris
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1rb9a_
  • Heterogens: FE2, SO4, FOR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rb9A (A:)
    mkkyvctvcgyeydpaegdpdngvkpgtsfddlpadwvcpvcgapksefeaa