PDB entry 1rb9

View 1rb9 on RCSB PDB site
Description: rubredoxin from desulfovibrio vulgaris refined anisotropically at 0.92 angstroms resolution
Deposited on 1997-12-21, released 1999-02-16
The last revision prior to the SCOP 1.55 freeze date was dated 1999-02-16, with a file datestamp of 1999-02-16.
Experiment type: XRAY
Resolution: 0.92 Å
R-factor: 0.0731
AEROSPACI score: 1.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1rb9__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rb9_ (-)
    mkkyvctvcgyeydpaegdpdngvkpgtsfddlpadwvcpvcgapksefeaa