PDB entry 1rb6

View 1rb6 on RCSB PDB site
Description: antiparallel trimer of gcn4-leucine zipper core mutant as n16a tetragonal form
Class: DNA binding protein
Keywords: coiled coil, leucine zipper, DNA binding protein
Deposited on 2003-11-01, released 2004-01-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: -1.64 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: General control protein GCN4
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03069 (0-32)
    • engineered (15)
  Domains in SCOPe 2.08: d1rb6a_
• Chain 'B':
  Compound: General control protein GCN4
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03069 (0-32)
    • engineered (15)
  Domains in SCOPe 2.08: d1rb6b_
• Chain 'C':
  Compound: General control protein GCN4
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03069 (0-End)
    • engineered (15)
  Domains in SCOPe 2.08: d1rb6c_
• Heterogens: CL, K, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rb6A (A:)
  rmkqledkveellskayhlenevarlkklvger
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rb6B (B:)
  rmkqledkveellskayhlenevarlkklvger
  

  
  
• Chain 'C':
  Sequence, based on SEQRES records: (download)
  

  >1rb6C (C:)
  rmkqledkveellskayhlenevarlkklvger
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1rb6C (C:)
  rmkqledkveellskayhlenevarlkklvg