PDB entry 1rap

View 1rap on RCSB PDB site
Description: the structure and function of omega loop a replacements in cytochrome c
Class: electron transport
Keywords: electron transport
Deposited on 1992-08-25, released 1993-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: rep a2 iso-1-cytochrome c
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00044 (0-107)
    • conflict (24-26)
    • conflict (29-30)
  Domains in SCOPe 2.08: d1rapa_
• Heterogens: SO4, HEM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rapA (A:)
  tefkagsakkgatlfktrclqchtfdqggankvgpnlhgifgrhsgqaegysytdanikk
  nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkace