PDB entry 1ra4

View 1ra4 on RCSB PDB site
Description: Crystal structure of the Methanococcus jannaschii L7Ae protein
Class: structural protein
Keywords: alpha-beta-alpha sandwich fold, STRUCTURAL PROTEIN
Deposited on 2003-10-31, released 2004-11-16
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.173
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 50S ribosomal protein L7Ae
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: RPL7AE, MJ1203
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ra4a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ra4A (A:)
    gshmavyvkfkvpeeiqkelldavakaqkikkganevtkavergiaklviiaedvkpeev
    vahlpylceekgipyayvaskqdlgkaaglevaassvaiinegdaeelkvliekvnvlkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ra4A (A:)
    mavyvkfkvpeeiqkelldavakaqkikkganevtkavergiaklviiaedvkpeevvah
    lpylceekgipyayvaskqdlgkaaglevaassvaiinegdaeelkvliekvnvlkq