PDB entry 1r8l

View 1r8l on RCSB PDB site
Description: The structure of endo-beta-1,4-galactanase from Bacillus licheniformis
Class: hydrolase
Keywords: (beta-alpha)8-barrel, calcium ion, glycosyl hydrolase, family 53, clan GH-A
Deposited on 2003-10-27, released 2004-11-02
The last revision prior to the SCOP 1.75 freeze date was dated 2004-11-02, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.186
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-beta-1,4-galactanase
    Species: Bacillus licheniformis
    Domains in SCOP 1.75: d1r8la_
  • Chain 'B':
    Compound: endo-beta-1,4-galactanase
    Species: Bacillus licheniformis
    Domains in SCOP 1.75: d1r8lb_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r8lA (A:)
    ahrdsgtaksglyvekvsglrkdfikgvdvssiialeesgvafynesgkkqdifktlkea
    gvnyvrvriwndpydangngygggnndlekaiqigkratangmklladfhysdfwadpak
    qkapkawanlnfedkktalyqytkqslkamkaagidigmvqvgnetngglagetdwakms
    qlfnagsqavretdsnilvalhftnpetsgryawiaetlhrhhvdydvfassyypfwhgt
    lknltsvltsvadtygkkvmvaetsytytaedgdghgntapkngqtlnnpvtvqgqanav
    rdviqavsdvgeagigvfywepawipvgpahrleknkalwetygsgwatsyaaeydpeda
    gkwfggsavdnqalfdfkgrplpslhvfqyvdtgtpfkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r8lA (A:)
    glyvekvsglrkdfikgvdvssiialeesgvafynesgkkqdifktlkeagvnyvrvriw
    ndpydangngygggnndlekaiqigkratangmklladfhysdfwadpakqkapkawanl
    nfedkktalyqytkqslkamkaagidigmvqvgnetngglagetdwakmsqlfnagsqav
    retdsnilvalhftnpetsgryawiaetlhrhhvdydvfassyypfwhgtlknltsvlts
    vadtygkkvmvaetsytytaedgdghgntapkngqtlnnpvtvqgqanavrdviqavsdv
    geagigvfywepawipvgpahrleknkalwetygsgwatsyaaeydpedagkwfggsavd
    nqalfdfkgrplpslhvfqyvdtgtp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r8lB (B:)
    ahrdsgtaksglyvekvsglrkdfikgvdvssiialeesgvafynesgkkqdifktlkea
    gvnyvrvriwndpydangngygggnndlekaiqigkratangmklladfhysdfwadpak
    qkapkawanlnfedkktalyqytkqslkamkaagidigmvqvgnetngglagetdwakms
    qlfnagsqavretdsnilvalhftnpetsgryawiaetlhrhhvdydvfassyypfwhgt
    lknltsvltsvadtygkkvmvaetsytytaedgdghgntapkngqtlnnpvtvqgqanav
    rdviqavsdvgeagigvfywepawipvgpahrleknkalwetygsgwatsyaaeydpeda
    gkwfggsavdnqalfdfkgrplpslhvfqyvdtgtpfkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r8lB (B:)
    glyvekvsglrkdfikgvdvssiialeesgvafynesgkkqdifktlkeagvnyvrvriw
    ndpydangngygggnndlekaiqigkratangmklladfhysdfwadpakqkapkawanl
    nfedkktalyqytkqslkamkaagidigmvqvgnetngglagetdwakmsqlfnagsqav
    retdsnilvalhftnpetsgryawiaetlhrhhvdydvfassyypfwhgtlknltsvlts
    vadtygkkvmvaetsytytaedgdghgntapkngqtlnnpvtvqgqanavrdviqavsdv
    geagigvfywepawipvgpahrleknkalwetygsgwatsyaaeydpedagkwfggsavd
    nqalfdfkgrplpslhvfqyvdtgtpf