PDB entry 1r8g

View 1r8g on RCSB PDB site
Description: Structure and function of YbdK
Class: ligase
Keywords: Structural Genomics, unknown function, YbdK, hypothetical protein, carboxylate-amine ligase, Structure 2 Function Project, S2F
Deposited on 2003-10-24, released 2004-08-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.189
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein ybdK
    Species: Escherichia coli [TaxId:562]
    Gene: YBDK, B0581
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77213
      • modified residue (19)
      • modified residue (35)
      • modified residue (57)
      • modified residue (78)
      • modified residue (170)
      • modified residue (194)
      • modified residue (215)
      • modified residue (240)
      • modified residue (252)
      • modified residue (347)
    Domains in SCOPe 2.06: d1r8ga_
  • Chain 'B':
    Compound: Hypothetical protein ybdK
    Species: Escherichia coli [TaxId:562]
    Gene: YBDK, B0581
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77213
      • modified residue (19)
      • modified residue (35)
      • modified residue (57)
      • modified residue (78)
      • modified residue (170)
      • modified residue (194)
      • modified residue (215)
      • modified residue (240)
      • modified residue (252)
      • modified residue (347)
    Domains in SCOPe 2.06: d1r8gb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r8gA (A:)
    mplpdfhvsepftlgielemqvvnppgydlsqdssmlidavknkitagevkhditesmle
    latdvcrdinqaagqfsamqkvvlqaatdhhleicgggthpfqkwqrqevcdneryqrtl
    enfgyliqqatvfgqhvhvgcasgddaiyllhglsrfvphfialsaaspymqgtdtrfas
    srpnifsafpdngpmpwvsnwqqfealfrclsyttmidsikdlhwdirpsphfgtvevrv
    mdtpltlshavnmagliqatahwllterpfkhqekdyllykfnrfqacryglegvitdph
    tgdrrpltedtlrllekiapsahkigassaiealhrqvvsglneaqlmrdfvadggslig
    lvkkhceiwagd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r8gA (A:)
    lpdfhvsepftlgielemqvvnppgydlsqdssmlidavknkitagevkhditesmlela
    tdvcrdinqaagqfsamqkvvlqaatdhhleicgggthpfqkwnfgyliqqatvfgqhvh
    vgcasgddaiyllhglsrfvphfialsaaspymqgtdtrfassrpnifsafpdngpmpwv
    snwqqfealfrclsyttmidsikdlhwdirpsphfgtvevrvmdtpltlshavnmagliq
    atahwllterpfkhqekdyllykfnrfqacryglegvitdphtgdrrpltedtlrlleki
    apsahkigassaiealhrqvvsglneaqlmrdfvadggsliglvkkhceiwa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r8gB (B:)
    mplpdfhvsepftlgielemqvvnppgydlsqdssmlidavknkitagevkhditesmle
    latdvcrdinqaagqfsamqkvvlqaatdhhleicgggthpfqkwqrqevcdneryqrtl
    enfgyliqqatvfgqhvhvgcasgddaiyllhglsrfvphfialsaaspymqgtdtrfas
    srpnifsafpdngpmpwvsnwqqfealfrclsyttmidsikdlhwdirpsphfgtvevrv
    mdtpltlshavnmagliqatahwllterpfkhqekdyllykfnrfqacryglegvitdph
    tgdrrpltedtlrllekiapsahkigassaiealhrqvvsglneaqlmrdfvadggslig
    lvkkhceiwagd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r8gB (B:)
    plpdfhvsepftlgielemqvvnppgydlsqdssmlidavknkitagevkhitesmlela
    tdvcrdinqaagqfsamqkvvlqaatdhhleicgggthpfqkwqqrtlenfgyliqqatv
    fgqhvhvgcasgddaiyllhglsrfvphfialsaaspymqgtdtrfassrpnifsafpdn
    gpmpwvsnwqqfealfrclsyttmidsikdlhwdirpsphfgtvevrvmdtpltlshavn
    magliqatahwllterpfkhqekdyllykfnrfqacryglegvitdphtgdrrpltedtl
    rllekiapsahkigassaiealhrqvvsglneaqlmrdfvadggsliglvkkhceiwa