PDB entry 1r82

View 1r82 on RCSB PDB site
Description: Glycosyltransferase B in complex with 3-amino-acceptor analog inhibitor, and uridine diphosphate-galactose
Class: Transferase
Keywords: Glycoprotein, transmembrane, signal-anchor, blood group antigen, Transferase
Deposited on 2003-10-22, released 2004-02-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.242
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycoprotein-fucosylgalactoside alpha-galactosyltransferase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16442 (1-282)
      • initiating met (0)
      • see remark 999 (172)
      • see remark 999 (203)
      • see remark 999 (205)
    Domains in SCOPe 2.07: d1r82a_
  • Heterogens: GDU, HG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r82A (A:)
    mvslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfa
    ikkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevgaykrwq
    dvsmrrmemisdfcerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpsfygssre
    aftyerrpqsqayipkdegdfyymgaffggsvqevqrltrachqammvdqangieavwhd
    eshlnkyllrhkptkvlspeylwdqqllgwpavlrklrftavp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r82A (A:)
    mvslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfa
    ikkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevcerrfls
    evdylvcvdvdmefrdhvgveiltplfgtlhpsfygssreaftyerrpqsqayipkdegd
    fyymgaffggsvqevqrltrachqammvdqangieavwhdeshlnkyllrhkptkvlspe
    ylwdqqllgwpavlrklrftavp