PDB entry 1r76

View 1r76 on RCSB PDB site
Description: Structure of a pectate lyase from Azospirillum irakense
Class: lyase
Keywords: a-helical structure, LYASE
Deposited on 2003-10-20, released 2004-06-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.198
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pectate lyase
    Species: Azospirillum irakense [TaxId:34011]
    Gene: PELA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r76a_
  • Heterogens: HG, CL, IPA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r76A (A:)
    avigmneaasaltpsrvsslpdtqraawqeylarseaqlsrdkaslaaelapgqplpppp
    aegkgadtmpldkpaawytskaarhvadvivsfqtpaggwgknqprdgalrlpgqhytge
    nvakvksgsndldaardrdwhyvgtidndatvteirflaqvvsqlapeeaapyrdaalkg
    ieyllasqfpnggwpqvwpleggyhdaitynddalvhvaellsdiaagrdgfgfvppair
    traleatnaaihcivetqvvqdgkrlgwgqqhdaltlrptsarnfepaalsstesarill
    flmeieapsdavkqairggvawlntsvirdrawvksdqgyqlvteqgakplwsrfysldg
    nkpvfgdrdktihddvmgisqerrtgyawyttspqkalsaftkwekrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r76A (A:)
    avigmneaasaltpsrvsslpdtqraawqeylarseaqlsrdkaslaaelapgqplpppp
    aegkgadtmpldkpaawytskaarhvadvivsfqtpaggwgknqprdgalrlpgqhytge
    nvakvkrdrdwhyvgtidndatvteirflaqvvsqlapeeaapyrdaalkgieyllasqf
    pnggwpqvwpleggyhdaitynddalvhvaellsdiaagrdgfgfvppairtraleatna
    aihcivetqvvqdgkrlgwgqqhdaltlrptsarnfepaalsstesarillflmeieaps
    davkqairggvawlntsvirdqgakplwsrfysldgnkpvfgdrdktihddvmgisqerr
    tgyawyttspqkalsaftkwekrs