PDB entry 1r76

View 1r76 on RCSB PDB site
Description: Structure of a pectate lyase from Azospirillum irakense
Deposited on 2003-10-20, released 2004-06-01
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-01, with a file datestamp of 2004-06-01.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.198
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1r76a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r76A (A:)
    avigmneaasaltpsrvsslpdtqraawqeylarseaqlsrdkaslaaelapgqplpppp
    aegkgadtmpldkpaawytskaarhvadvivsfqtpaggwgknqprdgalrlpgqhytge
    nvakvksgsndldaardrdwhyvgtidndatvteirflaqvvsqlapeeaapyrdaalkg
    ieyllasqfpnggwpqvwpleggyhdaitynddalvhvaellsdiaagrdgfgfvppair
    traleatnaaihcivetqvvqdgkrlgwgqqhdaltlrptsarnfepaalsstesarill
    flmeieapsdavkqairggvawlntsvirdrawvksdqgyqlvteqgakplwsrfysldg
    nkpvfgdrdktihddvmgisqerrtgyawyttspqkalsaftkwekrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r76A (A:)
    avigmneaasaltpsrvsslpdtqraawqeylarseaqlsrdkaslaaelapgqplpppp
    aegkgadtmpldkpaawytskaarhvadvivsfqtpaggwgknqprdgalrlpgqhytge
    nvakvkrdrdwhyvgtidndatvteirflaqvvsqlapeeaapyrdaalkgieyllasqf
    pnggwpqvwpleggyhdaitynddalvhvaellsdiaagrdgfgfvppairtraleatna
    aihcivetqvvqdgkrlgwgqqhdaltlrptsarnfepaalsstesarillflmeieaps
    davkqairggvawlntsvirdqgakplwsrfysldgnkpvfgdrdktihddvmgisqerr
    tgyawyttspqkalsaftkwekrs