PDB entry 1r73

View 1r73 on RCSB PDB site
Description: Solution Structure of TM1492, the L29 ribosomal protein from Thermotoga maritima
Class: ribosome
Keywords: ribosome, Structural Genomics, PSI, Protein Structure Initiative, Joint Center for Structural Genomics, JCSG
Deposited on 2003-10-17, released 2004-08-10
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 50S ribosomal protein L29
  Species: Thermotoga maritima [TaxId:2336]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P38514 (0-65)
  Domains in SCOPe 2.03: d1r73a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1r73A (A:)
  mkaselrnytdeelknlleekkrqlmelrfqlamgqlkntslikltkrdiariktilrer
  elgirr