PDB entry 1r72

View 1r72 on RCSB PDB site
Description: Crystal Structure of p25 from Thermus aquaticus
Deposited on 2003-10-17, released 2003-11-18
The last revision prior to the SCOP 1.67 freeze date was dated 2003-11-18, with a file datestamp of 2003-11-18.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.238
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r72A (A:)
    mkvpeaaisrlitylrileeleaqgvhrtsseqlgelaqvtafqvrkdlsyfgsygtrgv
    gytvpvlkrelrhilglnrkwglcivgmgrlgsaladypgfgesfelrgffdvdpekvgr
    pvrggviehvdllpqrvpgrieialltvpreaaqkaadllvaagikgilnfapvvlevpk
    evavenvdflagltrlsfailnpkwreemmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r72A (A:)
    kvpeaaisrlitylrileeleaqgvhrtsseqlgelaqvtafqvrkdlsyfgsygtrgvg
    ytvpvlkrelrhilglnrkwglcivgmgrlgsaladypgfgesfelrgffdvdpekvgrp
    vrggviehvdllpqrvpgrieialltvpreaaqkaadllvaagikgilnfapvvlevpke
    vavenvdflagltrlsfailnpkwr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r72B (B:)
    mkvpeaaisrlitylrileeleaqgvhrtsseqlgelaqvtafqvrkdlsyfgsygtrgv
    gytvpvlkrelrhilglnrkwglcivgmgrlgsaladypgfgesfelrgffdvdpekvgr
    pvrggviehvdllpqrvpgrieialltvpreaaqkaadllvaagikgilnfapvvlevpk
    evavenvdflagltrlsfailnpkwreemmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r72B (B:)
    peaaisrlitylrileeleaqgvhrtsseqlgelaqvtafqvrkdlsyfgsgytvpvlkr
    elrhilglnrkwglcivgmgrlgsaladypgfgesfelrgffdvdpekvgrpvrggvieh
    vdllpqrvpgrieialltvpreaaqkaadllvaagikgilnfapvvlevpkevavenvdf
    lagltrlsfailnpkwr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1r72C (C:)
    mkvpeaaisrlitylrileeleaqgvhrtsseqlgelaqvtafqvrkdlsyfgsygtrgv
    gytvpvlkrelrhilglnrkwglcivgmgrlgsaladypgfgesfelrgffdvdpekvgr
    pvrggviehvdllpqrvpgrieialltvpreaaqkaadllvaagikgilnfapvvlevpk
    evavenvdflagltrlsfailnpkwreemmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r72C (C:)
    peaaisrlitylrileeleaqgvhrtsseqlgelaqvtafqvrkdlsyfgsygytvpvlk
    relrhilglnrkwglcivgmgrlgsaladypgfgesfelrgffdvdpekvgrpvrggvie
    hvdllpqrvpgrieialltvpreaaqkaadllvaagikgilnfapvvlevpkevavenvd
    flagltrlsfailnpkw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1r72D (D:)
    mkvpeaaisrlitylrileeleaqgvhrtsseqlgelaqvtafqvrkdlsyfgsygtrgv
    gytvpvlkrelrhilglnrkwglcivgmgrlgsaladypgfgesfelrgffdvdpekvgr
    pvrggviehvdllpqrvpgrieialltvpreaaqkaadllvaagikgilnfapvvlevpk
    evavenvdflagltrlsfailnpkwreemmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r72D (D:)
    kvpeaaisrlitylrileeleaqgvhrtsseqlgelaqvtafqvrkdlsyfgsygtrgvg
    ytvpvlkrelrhilglnrkwglcivgmgrlgsaladypgfgesfelrgffdvdpekvgrp
    vrggviehvdllpqrvpgrieialltvpreaaqkaadllvaagikgilnfapvvlevpke
    vavenvdflagltrlsfailnpk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1r72E (E:)
    mkvpeaaisrlitylrileeleaqgvhrtsseqlgelaqvtafqvrkdlsyfgsygtrgv
    gytvpvlkrelrhilglnrkwglcivgmgrlgsaladypgfgesfelrgffdvdpekvgr
    pvrggviehvdllpqrvpgrieialltvpreaaqkaadllvaagikgilnfapvvlevpk
    evavenvdflagltrlsfailnpkwreemmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r72E (E:)
    mkvpeaaisrlitylrileeleaqgvhrtsseqlgelaqvtafqvrkdlsyfgsygtrgv
    gytvpvlkrelrhilglnrkwglcivgmgrlgsaladypgfgesfelrgffdvdpekvgr
    pvrggviehvdllpqrvpgrieialltvpreaaqkaadllvaagikgilnfapvvlevpk
    evavenvdflagltrlsfailnp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1r72F (F:)
    mkvpeaaisrlitylrileeleaqgvhrtsseqlgelaqvtafqvrkdlsyfgsygtrgv
    gytvpvlkrelrhilglnrkwglcivgmgrlgsaladypgfgesfelrgffdvdpekvgr
    pvrggviehvdllpqrvpgrieialltvpreaaqkaadllvaagikgilnfapvvlevpk
    evavenvdflagltrlsfailnpkwreemmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r72F (F:)
    vpeaaisrlitylrileeleaqgvhrtsseqlgelaqvtafqvrkdlsyfgsygytvpvl
    krelrhilglnrkwglcivgmgrlgsaladypgfgesfelrgffdvdpekvgrpvrggvi
    ehvdllpqrvpgrieialltvpreaaqkaadllvaagikgilnfapvvlevpkevavenv
    dflagltrlsfailnpkwre
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1r72G (G:)
    mkvpeaaisrlitylrileeleaqgvhrtsseqlgelaqvtafqvrkdlsyfgsygtrgv
    gytvpvlkrelrhilglnrkwglcivgmgrlgsaladypgfgesfelrgffdvdpekvgr
    pvrggviehvdllpqrvpgrieialltvpreaaqkaadllvaagikgilnfapvvlevpk
    evavenvdflagltrlsfailnpkwreemmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r72G (G:)
    peaaisrlitylrileeleaqgvhrtsseqlgelaqvtafqvrkdlsyfgytvpvlkrel
    rhilglnrkwglcivgmgrlgsaladypgfgesfelrgffdvdpekvgrpvrggviehvd
    llpqrvpgrieialltvpreaaqkaadllvaagikgilnfapvvlevpkevavenvdfla
    gltrlsfailnp