PDB entry 1r6q

View 1r6q on RCSB PDB site
Description: ClpNS with fragments
Class: chaperone/protein binding
Keywords: ClpA, AAA+, N-terminal domain, ClpS, crystal, binding mechanism
Deposited on 2003-10-16, released 2005-02-15
The last revision prior to the SCOP 1.75 freeze date was dated 2005-02-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.191
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent clp protease ATP-binding subunit clpa
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1r6qa1
  • Chain 'B':
    Compound: ATP-dependent clp protease ATP-binding subunit clpa
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1r6qb1
  • Chain 'C':
    Compound: ATP-dependent Clp protease adaptor protein clpS
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1r6qc1
  • Chain 'D':
    Compound: ATP-dependent Clp protease adaptor protein clpS
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1r6qd1
  • Heterogens: Y1, YBT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r6qA (A:)
    mlnqelelslnmafararehrhefmtvehlllallsnpsarealeacsvdlvalrqelea
    fieqttpvlpaseeerdtqptlsfqrvlqravfhvqssgrnevtganvlvaifseqesqa
    ayllrkhevsrldvvnfishgtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r6qA (A:)
    mlnqelelslnmafararehrhefmtvehlllallsnpsarealeacsvdlvalrqelea
    fieqttpvlpaseeerdtqptlsfqrvlqravfhvqssgrnevtganvlvaifseqesqa
    ayllrkhevsrldvvnfishgt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r6qB (B:)
    mlnqelelslnmafararehrhefmtvehlllallsnpsarealeacsvdlvalrqelea
    fieqttpvlpaseeerdtqptlsfqrvlqravfhvqssgrnevtganvlvaifseqesqa
    ayllrkhevsrldvvnfishgtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r6qB (B:)
    mlnqelelslnmafararehrhefmtvehlllallsnpsarealeacsvdlvalrqelea
    fieqttpvlpaseeerdtqptlsfqrvlqravfhvqssgrnevtganvlvaifseqesqa
    ayllrkhevsrldvvnfishgt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1r6qC (C:)
    mgktndwldfdqlaeekvrdalkppsmykvilvnddytpmefvidvlqkffsydveratq
    lmlavhyqgkaicgvftaevaetkvamvnkyarenehpllctleka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r6qC (C:)
    wldfdqldalkppsmykvilvnddytpmefvidvlqkffsydveratqlmlavhyqgkai
    cgvftaevaetkvamvnkyarenehpllctleka
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1r6qD (D:)
    mgktndwldfdqlaeekvrdalkppsmykvilvnddytpmefvidvlqkffsydveratq
    lmlavhyqgkaicgvftaevaetkvamvnkyarenehpllctleka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r6qD (D:)
    dwldfdqalkppsmykvilvnddytpmefvidvlqkffsydveratqlmlavhyqgkaic
    gvftaevaetkvamvnkyarenehpllctleka