PDB entry 1r6o

View 1r6o on RCSB PDB site
Description: ATP-dependent Clp protease ATP-binding subunit clpA/ATP-dependent Clp protease adaptor protein clpS
Class: hydrolase
Keywords: ClpA, AAA+, N-terminal domain, ClpS, crystal, binding mechanism
Deposited on 2003-10-15, released 2005-02-15
The last revision prior to the SCOP 1.75 freeze date was dated 2005-02-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.19
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent clp protease ATP-binding subunit clpa
    Species: Escherichia coli
    Gene: CLPA, LOPD, B0882, C1019, Z1119, ECS0968
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1r6oa1
  • Chain 'B':
    Compound: ATP-dependent clp protease ATP-binding subunit clpa
    Species: Escherichia coli
    Gene: CLPA, LOPD, B0882, C1019, Z1119, ECS0968
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1r6ob1
  • Chain 'C':
    Compound: ATP-dependent Clp protease adaptor protein clpS
    Species: Escherichia coli
    Gene: CLPS, B0881, C1018, Z1118, ECS0967, SF0841, S0881
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1r6oc1
  • Chain 'D':
    Compound: ATP-dependent Clp protease adaptor protein clpS
    Species: Escherichia coli
    Gene: CLPS, B0881, C1018, Z1118, ECS0967, SF0841, S0881
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1r6od1
  • Heterogens: CL, ZN, Y1, YBT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r6oA (A:)
    mlnqelelslnmafararehrhefmtvehlllallsnpsarealeacsvdlvalrqelea
    fieqttpvlpaseeerdtqptlsfqrvlqravfhvqssgrnevtganvlvaifseqesqa
    ayllrkhevsrldvvnfishgtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r6oA (A:)
    mlnqelelslnmafararehrhefmtvehlllallsnpsarealeacsvdlvalrqelea
    fieqttpvlpaseeerdtqptlsfqrvlqravfhvqssgrnevtganvlvaifseqesqa
    ayllrkhevsrldvvnfishgt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r6oB (B:)
    mlnqelelslnmafararehrhefmtvehlllallsnpsarealeacsvdlvalrqelea
    fieqttpvlpaseeerdtqptlsfqrvlqravfhvqssgrnevtganvlvaifseqesqa
    ayllrkhevsrldvvnfishgtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r6oB (B:)
    mlnqelelslnmafararehrhefmtvehlllallsnpsarealeacsvdlvalrqelea
    fieqttpvlpaseeerdtqptlsfqrvlqravfhvqssgrnevtganvlvaifseqesqa
    ayllrkhevsrldvvnfishg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1r6oC (C:)
    mgktndwldfdqlaeekvrdalkppsmykvilvnddytpmefvidvlqkffsydveratq
    lmlavhyqgkaicgvftaevaetkvamvnkyarenehpllctleka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r6oC (C:)
    wldfdqldalkppsmykvilvnddytpmefvidvlqkffsydveratqlmlavhyqgkai
    cgvftaevaetkvamvnkyarenehpllctleka
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1r6oD (D:)
    mgktndwldfdqlaeekvrdalkppsmykvilvnddytpmefvidvlqkffsydveratq
    lmlavhyqgkaicgvftaevaetkvamvnkyarenehpllctleka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r6oD (D:)
    ndwldfdqalkppsmykvilvnddytpmefvidvlqkffsydveratqlmlavhyqgkai
    cgvftaevaetkvamvnkyarenehpllctleka