PDB entry 1r6h

View 1r6h on RCSB PDB site
Description: Solution Structure of human PRL-3
Class: hydrolase
Keywords: dual specificity phosphatase fold, HYDROLASE
Deposited on 2003-10-15, released 2004-01-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein tyrosine phosphatase type IVA, member 3 isoform 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75365 (3-171)
      • cloning artifact (0-2)
    Domains in SCOPe 2.08: d1r6ha1, d1r6ha2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1r6hA (A:)
gshmarmnrpapvevsykhmrflithnptnatlstfiedlkkygattvvrvcevtydktp
lekdgitvvdwpfddgapppgkvvedwlslvkakfceapgscvavhcvaglgrapvlval
aliesgmkyedaiqfirqkrrgainskqltylekyrpkqrlrfkdphthktr