PDB entry 1r65

View 1r65 on RCSB PDB site
Description: Crystal structure of ferrous soaked Ribonucleotide Reductase R2 subunit (wildtype) at pH 5 from E. coli
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2003-10-14, released 2004-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.207
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonucleoside-diphosphate reductase 1 beta chain
    Species: Escherichia coli [TaxId:562]
    Gene: NRDB, FTSB, B2235, Z3491, ECS3118
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69924 (0-End)
      • see remark 999 (325)
    Domains in SCOPe 2.07: d1r65a_
  • Chain 'B':
    Compound: Ribonucleoside-diphosphate reductase 1 beta chain
    Species: Escherichia coli [TaxId:562]
    Gene: NRDB, FTSB, B2235, Z3491, ECS3118
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69924 (0-End)
      • see remark 999 (325)
    Domains in SCOPe 2.07: d1r65b_
  • Heterogens: FE2, HG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r65A (A:)
    ayttfsqtkndqlkepmffgqpvnvarydqqkydifekliekqlsffwrpeevdvsrdri
    dyqalpehekhifisnlkyqtlldsiqgrspnvallplisipeletwvetwafsetihsr
    sythiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
    tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardeal
    hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
    kdilcqyveyitnirmqavgldlpfntrsnpipwintwlvsdnvqvapqevevssylvgq
    idsevdtddlsnfql
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r65A (A:)
    ayttfsqtkndqlkepmffgqpvnvarydqqkydifekliekqlsffwrpeevdvsrdri
    dyqalpehekhifisnlkyqtlldsiqgrspnvallplisipeletwvetwafsetihsr
    sythiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
    tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardeal
    hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
    kdilcqyveyitnirmqavgldlpfntrsnpipwintwlv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r65B (B:)
    ayttfsqtkndqlkepmffgqpvnvarydqqkydifekliekqlsffwrpeevdvsrdri
    dyqalpehekhifisnlkyqtlldsiqgrspnvallplisipeletwvetwafsetihsr
    sythiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
    tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardeal
    hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
    kdilcqyveyitnirmqavgldlpfntrsnpipwintwlvsdnvqvapqevevssylvgq
    idsevdtddlsnfql
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r65B (B:)
    ayttfsqtkndqlkepmffgqpvnvarydqqkydifekliekqlsffwrpeevdvsrdri
    dyqalpehekhifisnlkyqtlldsiqgrspnvallplisipeletwvetwafsetihsr
    sythiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
    tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardeal
    hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
    kdilcqyveyitnirmqavgldlpfntrsnpipwintwlv