PDB entry 1r5v

View 1r5v on RCSB PDB site
Description: Evidence that structural rearrangements and/or flexibility during TCR binding can contribute to T-cell activation
Deposited on 2003-10-13, released 2004-02-03
The last revision prior to the SCOP 1.67 freeze date was dated 2004-02-10, with a file datestamp of 2004-02-10.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.213
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r5vA (A:)
    eehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgalan
    iavdkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvtwl
    rngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrkhwefee
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r5vB (B:)
    apwfleysksechfyngtqrvrllvryfynleenlrfdsdvgefravtelgrpdaenwns
    qpefleqkraevdtvcrhnyeifdnflvprrveptvtvyptktqplehhnllvcsvsdfy
    pgnievrwfrngkeektgivstglvrngdwtfqtlvmletvpqsgevytcqvehpsltdp
    vtvew
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r5vC (C:)
    eehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgalan
    iavdkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvtwl
    rngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrkhwefee
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r5vD (D:)
    apwfleysksechfyngtqrvrllvryfynleenlrfdsdvgefravtelgrpdaenwns
    qpefleqkraevdtvcrhnyeifdnflvprrveptvtvyptktqplehhnllvcsvsdfy
    pgnievrwfrngkeektgivstglvrngdwtfqtlvmletvpqsgevytcqvehpsltdp
    vtvew