PDB entry 1r5o

View 1r5o on RCSB PDB site
Description:
Deposited on 2003-10-11, released 2004-05-25
The last revision prior to the SCOP 1.69 freeze date was dated 2004-05-25, with a file datestamp of 2004-05-25.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.268
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r5oA (A:)
    sapaaalkkaaeaaepatvtedatdlqnevdqellkdmygkehvnivfighvdagkstlg
    gnilfltgmvdkrtmekiereakeagkeswylswaldstseerekgktvevgrayfeteh
    rrfslldapghkgyvtnmingasqadigvlvisarrgefeagferggqtrehavlartqg
    inhlvvvinkmdepsvqwseerykecvdklsmflrrvagynsktdvkympvsaytgqnvk
    drvdssvcpwyqgpslleyldsmthlerkvnapfimpiaskykdlgtilegkieagsikk
    nsnvlvmpinqtlevtaiydeadeeisssicgdqvrlrvrgddsdvqtgyvltstknpvh
    attrfiaqiailelpsilttgyscvmhihtaveevsfakllhkldktnrkskkppmfatk
    gmkiiaeletqtpvcmerfedyqymgrftlrdqgttvavgkvvkild
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r5oA (A:)
    tedatdlqnevdqellkdmygkehvnivfighvdagkstlggnilfltgmvdkrtmekie
    reakerayfetehrrfslldapgasqadigvlvisarrgefeagferggqtrehavlart
    qginhlvvvinkmdepsvqwseerykecvdklsmflrrvagynsktdvkympvsaytgqn
    vkdrvdssvcpwyqgpslleyldsmthlerkvnapfimpiaskykdlgtilegkieagsi
    kknsnvlvmpinqtlevtaiydeadeeisssicgdqvrlrvrgddsdvqtgyvltstknp
    vhattrfiaqiailelpsilttgyscvmhihtaveevsfakllhkldktnrkskkppmfa
    tkgmkiiaeletqtpvcmerfedyqymgrftlrdqgttvavgkvvkild