PDB entry 1r5k

View 1r5k on RCSB PDB site
Description: Human Estrogen Receptor alpha Ligand-Binding Domain In Complex With GW5638
Class: DNA binding protein
Keywords: Alpha helix, helical sandwich
Deposited on 2003-10-10, released 2004-11-23
The last revision prior to the SCOP 1.73 freeze date was dated 2005-05-31, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.208
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor
    Species: HOMO SAPIENS
    Gene: ESR1 OR NR3A1 OR ESR
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1r5ka_
  • Chain 'B':
    Compound: Estrogen receptor
    Species: HOMO SAPIENS
    Gene: ESR1 OR NR3A1 OR ESR
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1r5kb_
  • Chain 'C':
    Compound: Estrogen receptor
    Species: HOMO SAPIENS
    Gene: ESR1 OR NR3A1 OR ESR
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1r5kc_
  • Heterogens: GW5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r5kA (A:)
    mdpmikrskknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladre
    lvhminwakrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrn
    qgkcvegmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekd
    hihrvldkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknv
    vplydlllemldahrlhapts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r5kA (A:)
    lalsltadqmvsalldaeppilyseydfseasmmglltnladrelvhminwakrvpgfvd
    ltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifdmll
    atssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdtlihl
    makagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllemld
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r5kB (B:)
    mdpmikrskknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladre
    lvhminwakrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrn
    qgkcvegmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekd
    hihrvldkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknv
    vplydlllemldahrlhapts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r5kB (B:)
    lalsltadqmvsalldaeppilyseydfseasmmglltnladrelvhminwakrvpgfvd
    ltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifdmll
    atssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdtlihl
    makagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydllleml
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1r5kC (C:)
    mdpmikrskknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladre
    lvhminwakrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrn
    qgkcvegmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekd
    hihrvldkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknv
    vplydlllemldahrlhapts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r5kC (C:)
    lalsltadqmvsalldaeppilyseydfseasmmglltnladrelvhminwakrvpgfvd
    ltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifdmll
    atssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdtlihl
    makagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydllleml