PDB entry 1r4i

View 1r4i on RCSB PDB site
Description: Crystal Structure of Androgen Receptor DNA-Binding Domain Bound to a Direct Repeat Response Element
Class: transcription/DNA
Keywords: AR, Steroid Receptor, Protein-DNA Complex, Androgen, TRANSCRIPTION/DNA COMPLEX
Deposited on 2003-10-06, released 2004-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.246
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Androgen receptor
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Ar
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15207
      • engineered (19)
    Domains in SCOPe 2.07: d1r4ia_
  • Chain 'B':
    Compound: Androgen receptor
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Ar
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15207
      • engineered (19)
    Domains in SCOPe 2.07: d1r4ib_
  • Chain 'C':
    Compound: 5'-d(*cp*cp*ap*gp*ap*ap*cp*ap*tp*cp*ap*ap*gp*ap*ap*cp*ap*g)-3'
  • Chain 'D':
    Compound: 5'-d(*cp*tp*gp*tp*tp*cp*tp*tp*gp*ap*tp*gp*tp*tp*cp*tp*gp*g)-3'
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r4iA (A:)
    dyyfppqktclicgdeasgahygaltcgsckvffkraaegkqkylcasrndctidkfrrk
    ncpscrlrkcyeagmtlgarklkklgnlklqeegenssagspted
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r4iA (A:)
    pqktclicgdeasgahygaltcgsckvffkraaegkqkylcasrndctidkfrrkncpsc
    rlrkcyeagmtlga
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r4iB (B:)
    dyyfppqktclicgdeasgahygaltcgsckvffkraaegkqkylcasrndctidkfrrk
    ncpscrlrkcyeagmtlgarklkklgnlklqeegenssagspted
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r4iB (B:)
    ktclicgdeasgahygaltcgsckvffkraaegkqkylcasrndctidkfrrkncpscrl
    rkcyeagmtlg
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.