PDB entry 1r3n

View 1r3n on RCSB PDB site
Description: Crystal structure of beta-alanine synthase from Saccharomyces kluyveri
Deposited on 2003-10-02, released 2003-11-11
The last revision prior to the SCOP 1.69 freeze date was dated 2003-12-23, with a file datestamp of 2003-12-23.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.211
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r3nA (A:)
    skdvsstittvsaspdgtlnlpaaaplsiasgrlnqtiletgsqfggvarwgqeshefgm
    rrlagtaldgamrdwftneceslgckvkvdkignmfavypgknggkptatgshldtqpea
    gkydgilgvlaglevlrtfkdnnyvpnydvcvvvwfneegarfarsctgssvwshdlsle
    eayglmsvgedkpesvydslknigyigdtpasykeneidahfelhieqgpiledenkaig
    ivtgvqaynwqkvtvhgvgahagttpwrlrkdallmsskmivaaseiaqrhnglftcgii
    dakpysvniipgevsftldfrhpsddvlatmlkeaaaefdrlikindggalsyesetlqv
    spavnfhevciecvsrsafaqfkkdqvrqiwsgaghdscqtaphvptsmifipskdglsh
    nyyeysspeeiengfkvllqaiinydnyrvirghhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r3nA (A:)
    gtlnlpaaaplsiasgrlnqtiletgsqfggvarwgqeshefgmrrlagtaldgamrdwf
    tneceslgckvkvdkignmfavypgknggkptatgshldtqpeagkydgilgvlaglevl
    rtfkdnnyvpnydvcvvvwfneegarfarsctgssvwshdlsleeayglmsvgedkpesv
    ydslknigyigdtpasykeneidahfelhieqgpiledenkaigivtgvqaynwqkvtvh
    gvgahagttpwrlrkdallmsskmivaaseiaqrhnglftcgiidakpysvniipgevsf
    tldfrhpsddvlatmlkeaaaefdrlikindggalsyesetlqvspavnfhevciecvsr
    safaqfkkdqvrqiwsgaghdscqtaphvptsmifipskdglshnyyeysspeeiengfk
    vllqaiinydnyrvirgh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r3nB (B:)
    skdvsstittvsaspdgtlnlpaaaplsiasgrlnqtiletgsqfggvarwgqeshefgm
    rrlagtaldgamrdwftneceslgckvkvdkignmfavypgknggkptatgshldtqpea
    gkydgilgvlaglevlrtfkdnnyvpnydvcvvvwfneegarfarsctgssvwshdlsle
    eayglmsvgedkpesvydslknigyigdtpasykeneidahfelhieqgpiledenkaig
    ivtgvqaynwqkvtvhgvgahagttpwrlrkdallmsskmivaaseiaqrhnglftcgii
    dakpysvniipgevsftldfrhpsddvlatmlkeaaaefdrlikindggalsyesetlqv
    spavnfhevciecvsrsafaqfkkdqvrqiwsgaghdscqtaphvptsmifipskdglsh
    nyyeysspeeiengfkvllqaiinydnyrvirghhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r3nB (B:)
    paaaplsiasgrlnqtiletgsqfggvarwgqeshefgmrrlagtaldgamrdwftnece
    slgckvkvdkignmfavypgknggkptatgshldtqpeagkydgilgvlaglevlrtfkd
    nnyvpnydvcvvvwfneegarfarsctgssvwshdlsleeayglmsvgedkpesvydslk
    nigyigdtpasykeneidahfelhieqgpiledenkaigivtgvqaynwqkvtvhgvgah
    agttpwrlrkdallmsskmivaaseiaqrhnglftcgiidakpysvniipgevsftldfr
    hpsddvlatmlkeaaaefdrlikindggalsyesetlqvspavnfhevciecvsrsafaq
    fkkdqvrqiwsgaghdscqtaphvptsmifipskdglshnyyeysspeeiengfkvllqa
    iinydnyrvirgh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1r3nC (C:)
    skdvsstittvsaspdgtlnlpaaaplsiasgrlnqtiletgsqfggvarwgqeshefgm
    rrlagtaldgamrdwftneceslgckvkvdkignmfavypgknggkptatgshldtqpea
    gkydgilgvlaglevlrtfkdnnyvpnydvcvvvwfneegarfarsctgssvwshdlsle
    eayglmsvgedkpesvydslknigyigdtpasykeneidahfelhieqgpiledenkaig
    ivtgvqaynwqkvtvhgvgahagttpwrlrkdallmsskmivaaseiaqrhnglftcgii
    dakpysvniipgevsftldfrhpsddvlatmlkeaaaefdrlikindggalsyesetlqv
    spavnfhevciecvsrsafaqfkkdqvrqiwsgaghdscqtaphvptsmifipskdglsh
    nyyeysspeeiengfkvllqaiinydnyrvirghhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r3nC (C:)
    gtlnlpaaaplsiasgrlnqtiletgsqfggvarwgqeshefgmrrlagtaldgamrdwf
    tneceslgckvkvdkignmfavypgknggkptatgshldtqpeagkydgilgvlaglevl
    rtfkdnnyvpnydvcvvvwfneegarfarsctgssvwshdlsleeayglmsvgedkpesv
    ydslknigyigdtpasykeneidahfelhieqgpiledenkaigivtgvqaynwqkvtvh
    gvgahagttpwrlrkdallmsskmivaaseiaqrhnglftcgiidakpysvniipgevsf
    tldfrhpsddvlatmlkeaaaefdrlikindggalsyesetlqvspavnfhevciecvsr
    safaqfkkdqvrqiwsgaghdscqtaphvptsmifipskdglshnyyeysspeeiengfk
    vllqaiinydnyrvirgh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1r3nD (D:)
    skdvsstittvsaspdgtlnlpaaaplsiasgrlnqtiletgsqfggvarwgqeshefgm
    rrlagtaldgamrdwftneceslgckvkvdkignmfavypgknggkptatgshldtqpea
    gkydgilgvlaglevlrtfkdnnyvpnydvcvvvwfneegarfarsctgssvwshdlsle
    eayglmsvgedkpesvydslknigyigdtpasykeneidahfelhieqgpiledenkaig
    ivtgvqaynwqkvtvhgvgahagttpwrlrkdallmsskmivaaseiaqrhnglftcgii
    dakpysvniipgevsftldfrhpsddvlatmlkeaaaefdrlikindggalsyesetlqv
    spavnfhevciecvsrsafaqfkkdqvrqiwsgaghdscqtaphvptsmifipskdglsh
    nyyeysspeeiengfkvllqaiinydnyrvirghhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r3nD (D:)
    tlnlpaaaplsiasgrlnqtiletgsqfggvarwgqeshefgmrrlagtaldgamrdwft
    neceslgckvkvdkignmfavypgknggkptatgshldtqpeagkydgilgvlaglevlr
    tfkdnnyvpnydvcvvvwfneegarfarsctgssvwshdlsleeayglmsvgedkpesvy
    dslknigyigdtpasykeneidahfelhieqgpiledenkaigivtgvqaynwqkvtvhg
    vgahagttpwrlrkdallmsskmivaaseiaqrhnglftcgiidakpysvniipgevsft
    ldfrhpsddvlatmlkeaaaefdrlikindggalsyesetlqvspavnfhevciecvsrs
    afaqfkkdqvrqiwsgaghdscqtaphvptsmifipskdglshnyyeysspeeiengfkv
    llqaiinydnyrvirgh
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1r3nE (E:)
    skdvsstittvsaspdgtlnlpaaaplsiasgrlnqtiletgsqfggvarwgqeshefgm
    rrlagtaldgamrdwftneceslgckvkvdkignmfavypgknggkptatgshldtqpea
    gkydgilgvlaglevlrtfkdnnyvpnydvcvvvwfneegarfarsctgssvwshdlsle
    eayglmsvgedkpesvydslknigyigdtpasykeneidahfelhieqgpiledenkaig
    ivtgvqaynwqkvtvhgvgahagttpwrlrkdallmsskmivaaseiaqrhnglftcgii
    dakpysvniipgevsftldfrhpsddvlatmlkeaaaefdrlikindggalsyesetlqv
    spavnfhevciecvsrsafaqfkkdqvrqiwsgaghdscqtaphvptsmifipskdglsh
    nyyeysspeeiengfkvllqaiinydnyrvirghhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r3nE (E:)
    paaaplsiasgrlnqtiletgsqfggvarwgqeshefgmrrlagtaldgamrdwftnece
    slgckvkvdkignmfavypgknggkptatgshldtqpeagkydgilgvlaglevlrtfkd
    nnyvpnydvcvvvwfneegarfarsctgssvwshdlsleeayglmsvgedkpesvydslk
    nigyigdtpasykeneidahfelhieqgpiledenkaigivtgvqaynwqkvtvhgvgah
    agttpwrlrkdallmsskmivaaseiaqrhnglftcgiidakpysvniipgevsftldfr
    hpsddvlatmlkeaaaefdrlikindggalsyesetlqvspavnfhevciecvsrsafaq
    fkkdqvrqiwsgaghdscqtaphvptsmifipskdglshnyyeysspeeiengfkvllqa
    iinydnyrvirgh
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1r3nF (F:)
    skdvsstittvsaspdgtlnlpaaaplsiasgrlnqtiletgsqfggvarwgqeshefgm
    rrlagtaldgamrdwftneceslgckvkvdkignmfavypgknggkptatgshldtqpea
    gkydgilgvlaglevlrtfkdnnyvpnydvcvvvwfneegarfarsctgssvwshdlsle
    eayglmsvgedkpesvydslknigyigdtpasykeneidahfelhieqgpiledenkaig
    ivtgvqaynwqkvtvhgvgahagttpwrlrkdallmsskmivaaseiaqrhnglftcgii
    dakpysvniipgevsftldfrhpsddvlatmlkeaaaefdrlikindggalsyesetlqv
    spavnfhevciecvsrsafaqfkkdqvrqiwsgaghdscqtaphvptsmifipskdglsh
    nyyeysspeeiengfkvllqaiinydnyrvirghhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r3nF (F:)
    gtlnlpaaaplsiasgrlnqtiletgsqfggvarwgqeshefgmrrlagtaldgamrdwf
    tneceslgckvkvdkignmfavypgknggkptatgshldtqpeagkydgilgvlaglevl
    rtfkdnnyvpnydvcvvvwfneegarfarsctgssvwshdlsleeayglmsvgedkpesv
    ydslknigyigdtpasykeneidahfelhieqgpiledenkaigivtgvqaynwqkvtvh
    gvgahagttpwrlrkdallmsskmivaaseiaqrhnglftcgiidakpysvniipgevsf
    tldfrhpsddvlatmlkeaaaefdrlikindggalsyesetlqvspavnfhevciecvsr
    safaqfkkdqvrqiwsgaghdscqtaphvptsmifipskdglshnyyeysspeeiengfk
    vllqaiinydnyrvirgh
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1r3nG (G:)
    skdvsstittvsaspdgtlnlpaaaplsiasgrlnqtiletgsqfggvarwgqeshefgm
    rrlagtaldgamrdwftneceslgckvkvdkignmfavypgknggkptatgshldtqpea
    gkydgilgvlaglevlrtfkdnnyvpnydvcvvvwfneegarfarsctgssvwshdlsle
    eayglmsvgedkpesvydslknigyigdtpasykeneidahfelhieqgpiledenkaig
    ivtgvqaynwqkvtvhgvgahagttpwrlrkdallmsskmivaaseiaqrhnglftcgii
    dakpysvniipgevsftldfrhpsddvlatmlkeaaaefdrlikindggalsyesetlqv
    spavnfhevciecvsrsafaqfkkdqvrqiwsgaghdscqtaphvptsmifipskdglsh
    nyyeysspeeiengfkvllqaiinydnyrvirghhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r3nG (G:)
    aplsiasgrlnqtiletgsqfggvarwgqeshefgmrrlagtaldgamrdwftneceslg
    ckvkvdkignmfavypgknggkptatgshldtqpeagkydgilgvlaglevlrtfkdnny
    vpnydvcvvvwfneegarfarsctgssvwshdlsleeayglmsvgedkpesvydslknig
    yigdtpasykeneidahfelhieqgpiledenkaigivtgvqaynwqkvtvhgvgahagt
    tpwrlrkdallmsskmivaaseiaqrhnglftcgiidakpysvniipgevsftldfrhps
    ddvlatmlkeaaaefdrlikindggalsyesetlqvspavnfhevciecvsrsafaqfkk
    dqvrqiwsgaghdscqtaphvptsmifipskdglshnyyeysspeeiengfkvllqaiin
    ydnyrvirgh
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1r3nH (H:)
    skdvsstittvsaspdgtlnlpaaaplsiasgrlnqtiletgsqfggvarwgqeshefgm
    rrlagtaldgamrdwftneceslgckvkvdkignmfavypgknggkptatgshldtqpea
    gkydgilgvlaglevlrtfkdnnyvpnydvcvvvwfneegarfarsctgssvwshdlsle
    eayglmsvgedkpesvydslknigyigdtpasykeneidahfelhieqgpiledenkaig
    ivtgvqaynwqkvtvhgvgahagttpwrlrkdallmsskmivaaseiaqrhnglftcgii
    dakpysvniipgevsftldfrhpsddvlatmlkeaaaefdrlikindggalsyesetlqv
    spavnfhevciecvsrsafaqfkkdqvrqiwsgaghdscqtaphvptsmifipskdglsh
    nyyeysspeeiengfkvllqaiinydnyrvirghhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r3nH (H:)
    gtlnlpaaaplsiasgrlnqtiletgsqfggvarwgqeshefgmrrlagtaldgamrdwf
    tneceslgckvkvdkignmfavypgknggkptatgshldtqpeagkydgilgvlaglevl
    rtfkdnnyvpnydvcvvvwfneegarfarsctgssvwshdlsleeayglmsvgedkpesv
    ydslknigyigdtpasykeneidahfelhieqgpiledenkaigivtgvqaynwqkvtvh
    gvgahagttpwrlrkdallmsskmivaaseiaqrhnglftcgiidakpysvniipgevsf
    tldfrhpsddvlatmlkeaaaefdrlikindggalsyesetlqvspavnfhevciecvsr
    safaqfkkdqvrqiwsgaghdscqtaphvptsmifipskdglshnyyeysspeeiengfk
    vllqaiinydnyrvirgh