PDB entry 1r2w

View 1r2w on RCSB PDB site
Description: Coordinates of L11 with 58nts of 23S rRNA fitted into the cryo-EM map of the 70S ribosome
Class: RNA binding protein/RNA
Keywords: rna, ribosomal protein, RNA BINDING PROTEIN/RNA COMPLEX
Deposited on 2003-09-30, released 2003-11-04
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-06.
Experiment type: EM
Resolution: 9 Å
R-factor: N/A
AEROSPACI score: -0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 50S ribosomal protein L11
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29395
      • insertion (71)
    Domains in SCOPe 2.01: d1r2wa_
  • Chain 'C':
    Compound: 58nts of 23S rRNA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1r2wA (A:)
akkvaaqiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvy
edksftfiikteppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnans
leaamkiiegtaksmgievvd

    Sequence, based on observed residues (ATOM records): (download) 
    >1r2wA (A:)
qiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvyedksft
fiikteppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamk
iiegtaksmgievv

  • Chain 'C':
    No sequence available.