PDB entry 1r2v

View 1r2v on RCSB PDB site
Description:
Deposited on 2003-09-30, released 2004-06-08
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-08, with a file datestamp of 2004-06-08.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: 0.198
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1r2va1, d1r2va2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r2vA (A:)
    yklicyytswsqyregdgscfpdaidpflcthviysfanisnneidtwewndvtlydtln
    tlknrnpklktllsvggwnfgperfsaiasktqsrrtfiksvppflrthgfdgldlawly
    pgrrdkrhlttlvkemkaefireaqagteqlllsaavsagkiaidrgydiaqisrhldfi
    slltydfhgawrqtvghhsplfagnedassrfsnadyavsymlrlgapanklvmgiptfg
    rsftlassktdvgapvsgpgvpgrftkekgilayyeicdflhgatthrfrdqqvpyatkg
    nqwvayddqesvknkarylknrqlagamvwaldlddfrgtfcgqnltfpltsavkdvlae
    v