PDB entry 1r2v

View 1r2v on RCSB PDB site
Description: Crystal structure of a secretory 40kDa glycoprotein from sheep mammary gland at 2.0A resolution
Class: signaling protein
Keywords: mammary gland secretion, involution, signaling protein
Deposited on 2003-09-30, released 2004-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2006-05-30, with a file datestamp of 2007-06-01.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: 0.198
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: signal processing protein
    Species: Ovis aries
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB AAQ94054 (0-360)
    Domains in SCOPe 2.07: d1r2va3, d1r2va4
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r2vA (A:)
    yklicyytswsqyregdgscfpdaidpflcthviysfanisnneidtwewndvtlydtln
    tlknrnpklktllsvggwnfgperfsaiasktqsrrtfiksvppflrthgfdgldlawly
    pgrrdkrhlttlvkemkaefireaqagteqlllsaavsagkiaidrgydiaqisrhldfi
    slltydfhgawrqtvghhsplfagnedassrfsnadyavsymlrlgapanklvmgiptfg
    rsftlassktdvgapvsgpgvpgrftkekgilayyeicdflhgatthrfrdqqvpyatkg
    nqwvayddqesvknkarylknrqlagamvwaldlddfrgtfcgqnltfpltsavkdvlae
    v