PDB entry 1r2j

View 1r2j on RCSB PDB site
Description:
Deposited on 2003-09-28, released 2003-11-25
The last revision prior to the SCOP 1.67 freeze date was dated 2003-11-25, with a file datestamp of 2003-11-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.247
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1r2ja1, d1r2ja2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r2jA (A:)
    mperdalltdlvgdraaewdtsgelprdllvrlgadgllcaevaaehgglglgsrengef
    tahvgslcsslrsvmtsqgmaawtvqrlgdagqratflkeltsgklaavgfserqagsdl
    samrtrvrldgdtavvdghkvwttaaayadhlvvfglqedgsgavvvvpadtpgvrverv
    pkpsgcraaghadlhldqvrvpagavlagsgaslpmlvaaslaygrksvawgcvgilrac
    rtaavahartreqfgrplgdhqlvaghiadlwtaeqiaarvceyasdhwdegspemvpat
    ilakhvaaeraaagaataaqvlasagareghvverayrdaklmeiiegssemcrvmlaqh
    alalpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r2jA (A:)
    erdalltdlvgdraaewdtsgelprdllvrlgadgllcaevaaehgglglgsrengefta
    hvgslcsslrsvmtsqgmaawtvqrlgdagqratflkeltsglaavgfserqagsdlsam
    rtrvrldgdtavvdghkvwttaaayadhlvvfglqedgsgavvvvpadtpgvrvervpkp
    sgcraaghadlhldqvrvpagavlagsgaslpmlvaaslaygrksvawgcvgilracrta
    avahartreqfgrplgdhqlvaghiadlwtaeqiaarvceyasdhmvpatilakhvaaer
    aaagaataaqvlasagaghvverayrdaklmeiiegssemcrvmlaqhalalp