PDB entry 1r2f

View 1r2f on RCSB PDB site
Description: ribonucleotide reductase r2f protein from salmonella typhimurium
Deposited on 1998-08-24, released 1999-01-13
The last revision prior to the SCOP 1.67 freeze date was dated 1999-12-29, with a file datestamp of 1999-12-28.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.226
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1r2fa_
  • Chain 'B':
    Domains in SCOP 1.67: d1r2fb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r2fA (A:)
    mklsrisainwnkiqddkdlevwnrltsnfwlpekvplsndipawqtlsaaeqqltirvf
    tgltlldtiqniagapslmadaitpheeavlsnisfmeavharsyssifstlcqtkevda
    ayawseenpplqrkaqiilahyvsdeplkkkiasvflesflfysgfwlpmyfssrgkltn
    tadlirliirdeavhgyyigykyqialqklsaiereelklfaldllmelydneiryteal
    yaetgwvndvkaflcynankalmnlgyealfppemadvnpailaalspnadenhdffsgs
    gssyvmgktvetededwnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r2fA (A:)
    isainwnkiqddkdlevwnrltsnfwlpekvplsndipawqtlsaaeqqltirvftgltl
    ldtiqniagapslmadaitpheeavlsnisfmeavharsyssifstlcqtkevdaayaws
    eenpplqrkaqiilahyvsdeplkkkiasvflesflfysgfwlpmyfssrgkltntadli
    rliirdeavhgyyigykyqialqklsaiereelklfaldllmelydneirytealyaetg
    wvndvkaflcynankalmnlgyealfppemadvnpailaalsp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r2fB (B:)
    mklsrisainwnkiqddkdlevwnrltsnfwlpekvplsndipawqtlsaaeqqltirvf
    tgltlldtiqniagapslmadaitpheeavlsnisfmeavharsyssifstlcqtkevda
    ayawseenpplqrkaqiilahyvsdeplkkkiasvflesflfysgfwlpmyfssrgkltn
    tadlirliirdeavhgyyigykyqialqklsaiereelklfaldllmelydneiryteal
    yaetgwvndvkaflcynankalmnlgyealfppemadvnpailaalspnadenhdffsgs
    gssyvmgktvetededwnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r2fB (B:)
    isainwnkiqddkdlevwnrltsnfwlpekvplsndipawqtlsaaeqqltirvftgltl
    ldtiqniagapslmadaitpheeavlsnisfmeavharsyssifstlcqtkevdaayaws
    eenpplqrkaqiilahyvsdeplkkkiasvflesflfysgfwlpmyfssrgkltntadli
    rliirdeavhgyyigykyqialqklsaiereelklfaldllmelydneirytealyaetg
    wvndvkaflcynankalmnlgyealfppemadvnpailaal