PDB entry 1r2c

View 1r2c on RCSB PDB site
Description: photosynthetic reaction center blastochloris viridis (atcc)
Class: photosynthesis
Keywords: photosynthetic reaction center, secondary quinone (qb), photosynthesis
Deposited on 2003-09-26, released 2004-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.86 Å
R-factor: 0.202
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: Photosynthetic reaction center cytochrome C subunit precursor
    Species: Blastochloris viridis [TaxId:1079]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r2cc_
  • Chain 'H':
    Compound: reaction center protein h chain
    Species: Blastochloris viridis [TaxId:1079]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06008 (0-257)
      • modified residue (0)
    Domains in SCOPe 2.07: d1r2ch1, d1r2ch2
  • Chain 'L':
    Compound: reaction center protein l chain
    Species: Blastochloris viridis [TaxId:1079]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r2cl_
  • Chain 'M':
    Compound: reaction center protein m chain
    Species: Blastochloris viridis [TaxId:1079]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r2cm_
  • Heterogens: FE2, SO4, HEM, BCB, BPB, MQ7, UQ2, NS5, LDA

PDB Chain Sequences:

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1r2cC (C:)
    cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk
    vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn
    wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt
    aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl
    gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea
    pqadcrtchqgvtkplfgasrlkdypelgpikaaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r2cC (C:)
    cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk
    vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn
    wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt
    aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl
    gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea
    pqadcrtchqgvtkplfgasrlkdypelgpik
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r2cH (H:)
    myhgalaqhldiaqlvwyaqwlviwtvvllylrredrregyplveplglvklapedgqvy
    elpypktfvlphggtvtvprrrpetrelklaqtdgfegaplqptgnplvdavgpasyaer
    aevvdatvdgkakivplrvatdfsiaegdvdprglpvvaadgveagtvtdlwvdrsehyf
    rylelsvagsartaliplgfcdvkkdkivvtsilseqfanvprlqsrdqitlreedkvsa
    yyaggllyatperaesll
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r2cL (L:)
    allsferkyrvrggtliggdlfdfwvgpyfvgffgvsaiffiflgvsligyaasqgptwd
    pfaisinppdlkyglgaaplleggfwqaitvcalgafiswmlreveisrklgigwhvpla
    fcvpifmfcvlqvfrplllgswghafpygilshldwvnnfgyqylnwhynpghmssvsfl
    fvnamalglhgglilsvanpgdgdkvktaehenqyfrdvvgysigalsihrlglflasni
    fltgafgtiasgpfwtrgwpewwgwwldipfws
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r2cM (M:)
    adyqtiytqiqargphitvsgewgdndrvgkpfysywlgkigdaqigpiylgasgiaafa
    fgstailiilfnmaaevhfdplqffrqffwlglyppkaqygmgipplhdggwwlmaglfm
    tlslgswwirvysraralglgthiawnfaaaiffvlcigcihptlvgswsegvpfgiwph
    idwltafsirygnfyycpwhgfsigfaygcgllfaahgatilavarfggdreieqitdrg
    taveraalfwrwtigfnatiesvhrwgwffslmvmvsasvgilltgtfvdnwylwcvkhg
    aapdypaylpatpdpaslpgapk