PDB entry 1r29

View 1r29 on RCSB PDB site
Description: crystal structure of the b-cell lymphoma 6 (bcl6) btb domain to 1.3 angstrom
Deposited on 2003-09-26, released 2003-12-23
The last revision prior to the SCOP 1.69 freeze date was dated 2003-12-23, with a file datestamp of 2003-12-23.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.131
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1r29a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r29A (A:)
    gsadsqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysift
    dqlkrnlsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqmehvvdtcr
    kfikase
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r29A (A:)
    sqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysiftdqlk
    rnlsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqmehvvdtcrkfik
    as