PDB entry 1r27

View 1r27 on RCSB PDB site
Description: crystal structure of nargh complex
Deposited on 2003-09-26, released 2004-02-17
The last revision prior to the SCOP 1.71 freeze date was dated 2004-02-17, with a file datestamp of 2004-02-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.204
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r27A (A:)
    skfldrfryfkqkgetfadghgqllntnrdwedgyrqrwqhdkivrsthgvnctgscswk
    iyvknglvtwetqqtdyprtrpdlpnheprgcprgasyswylysanrlkypmmrkrlmkm
    wreakalhsdpveawasiiedadkaksfkqargrggfvrsswqevneliaasnvytikny
    gpdrvagfspipamsmvsyasgarylsliggtclsfydwycdlppaspqtwgeqtdvpes
    adwynssyiiawgsnvpqtrtpdahfftevrykgtktvavtpdyaeiaklcdlwlapkqg
    tdaamalamghvmlrefhldnpsqyftdyvrrytdmpmlvmleerdgyyaagrmlraadl
    vdalgqennpewktvafntngemvapngsigfrwgekgkwnleqrdgktgeetelqlsll
    gsqdeiaevgfpyfggdgtehfnkvelenvllhklpvkrlqladgstalvttvydltlan
    yglerglndvncatsyddvkaytpawaeqitgvsrsqiiriarefadnadkthgrsmiiv
    gaglnhwyhldmnyrglinmlifcgcvgqsgggwahyvgqeklrpqtgwqplafaldwqr
    parhmnstsyfynhssqwryetvtaeellspmadksrytghlidfnvraermgwlpsapq
    lgtnpltiageaekagmnpvdytvkslkegsirfaaeqpengknhprnlfiwrsnllgss
    gkghefmlkyllgtehgiqgkdlgqqggvkpeevdwqdnglegkldlvvtldfrlsstcl
    ysdiilptatwyekddmntsdmhpfihplsaavdpaweaksdweiykaiakkfsevcvgh
    lgketdivtlpiqhdsaaelaqpldvkdwkkgecdlipgktaphimvverdypatyerft
    sigplmekignggkgiawntqsemdllrklnytkaegpakgqpmlntaidaaemiltlap
    etngqvavkawaalseftgrdhthlalnkedekirfrdiqaqprkiissptwsgledehv
    synagytnvhelipwrtlsgrqqlyqdhqwmrdfgesllvyrppidtrsvkevigqksng
    nqekalnfltphqkwgihstysdnllmltlgrggpvvwlseadakdlgiadndwievfns
    ngaltaravvsqrvpagmtmmyhaqerivnlpgseitqqrggihnsvtritpkpthmigg
    yahlaygfnyygtvgsnrdefvvvrkmknidwldgegndqvqesvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r27A (A:)
    rdwedgyrqrwqhdkivrsthgvnctgscswkiyvknglvtwetqqtdyprtrpdlpnhe
    prgcprgasyswylysanrlkypmmrkrlmkmwreakalhsdpveawasiiedadkaksf
    kqargrggfvrsswqevneliaasnvytiknygpdrvagfspipamsmvsyasgarylsl
    iggtclsfydwycdlppaspqtwgeqtdvpesadwynssyiiawgsnvpqtrtpdahfft
    evrykgtktvavtpdyaeiaklcdlwlapkqgtdaamalamghvmlrefhldnpsqyftd
    yvrrytdmpmlvmleerdgyyaagrmlraadlvdalgqennpewktvafntngemvapng
    sigfrwgekgkwnleqrdgktgeetelqlsllgsqdeiaevgfpyfggdgtehfnkvele
    nvllhklpvkrlqladgstalvttvydltlanyglerglndvncatsyddvkaytpawae
    qitgvsrsqiiriarefadnadkthgrsmiivgaglnhwyhldmnyrglinmlifcgcvg
    qsgggwahyvgqeklrpqtgwqplafaldwqrparhmnstsyfynhssqwryetvtaeel
    lspmadksrytghlidfnvraermgwlpsapqlgtnpltiageaekagmnpvdytvkslk
    egsirfaaeqpengknhprnlfiwrsnllgssgkghefmlkyllgtehgiqgkdlgqqgg
    vkpeevdwqdnglegkldlvvtldfrlsstclysdiilptatwyekddmntsdmhpfihp
    lsaavdpaweaksdweiykaiakkfsevcvghlgketdivtlpiqhdsaaelaqpldvkd
    wkkgecdlipgktaphimvverdypatyerftsigplmekignggkgiawntqsemdllr
    klnytkaegpakgqpmlntaidaaemiltlapetngqvavkawaalseftgrdhthlaln
    kedekirfrdiqaqprkiissptwsgledehvsynagytnvhelipwrtlsgrqqlyqdh
    qwmrdfgesllvyrppidtrsvkevigqksngnqekalnfltphqkwgihstysdnllml
    tlgrggpvvwlseadakdlgiadndwievfnsngaltaravvsqrvpagmtmmyhaqeri
    vnlpgseitqqrggihnsvtritpkpthmiggyahlaygfnyygtvgsnrdefvvvrkmk
    nidwldgegndqvqesvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r27B (B:)
    mkirsqvgmvlnldkcigchtcsvtcknvwtsregveyawfnnvetkpgqgfptdwenqe
    kykggwirkingklqprmgnramllgkifanphlpgiddyyepfdfdyqnlhtapegsks
    qpiarprslitgermakiekgpnweddlggefdklakdknfdniqkamysqfentfmmyl
    prlcehclnpacvatcpsgaiykreedgivlidqdkcrgwrmcitgcpykkiyfnwksgk
    sekcifcyprieagqptvcsetcvgrirylgvllydadaieraastenekdlyqrqldvf
    ldpndpkvieqaikdgiplsvieaaqqspvykmamewklalplhpeyrtlpmvwyvppls
    piqsaadagelgsngilpdveslripvqylanlltagdtkpvlralkrmlamrhykraet
    vdgkvdtraleevglteaqaqemyrylaianyedrfvvpsshrelareafpekngcgftf
    gdgchgsdtkfnlfnsrridaidvtsktephp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r27B (B:)
    mkirsqvgmvlnldkcigchtcsvtcknvwtsregveyawfnnvetkpgqgfptdwenqe
    kykggwirkingklqprmgnramllgkifanphlpgiddyyepfdfdyqnlhtapegsks
    qpiarprslitgermakiekgpnweddlggefdklakdknfdniqkamysqfentfmmyl
    prlcehclnpacvatcpsgaiykreedgivlidqdkcrgwrmcitgcpykkiyfnwksgk
    sekcifcyprieagqptvcsetcvgrirylgvllydadaieraastenekdlyqrqldvf
    ldpndpkvieqaikdgiplsvieaaqqspvykmamewklalplhpeyrtlpmvwyvppls
    piqsaadagelgsngilpdveslripvqylanlltagdtkpvlralkrmlamrhykraet
    vdgkvdtraleevglteaqaqemyrylaianyedrfvvpsshrel
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1r27C (C:)
    skfldrfryfkqkgetfadghgqllntnrdwedgyrqrwqhdkivrsthgvnctgscswk
    iyvknglvtwetqqtdyprtrpdlpnheprgcprgasyswylysanrlkypmmrkrlmkm
    wreakalhsdpveawasiiedadkaksfkqargrggfvrsswqevneliaasnvytikny
    gpdrvagfspipamsmvsyasgarylsliggtclsfydwycdlppaspqtwgeqtdvpes
    adwynssyiiawgsnvpqtrtpdahfftevrykgtktvavtpdyaeiaklcdlwlapkqg
    tdaamalamghvmlrefhldnpsqyftdyvrrytdmpmlvmleerdgyyaagrmlraadl
    vdalgqennpewktvafntngemvapngsigfrwgekgkwnleqrdgktgeetelqlsll
    gsqdeiaevgfpyfggdgtehfnkvelenvllhklpvkrlqladgstalvttvydltlan
    yglerglndvncatsyddvkaytpawaeqitgvsrsqiiriarefadnadkthgrsmiiv
    gaglnhwyhldmnyrglinmlifcgcvgqsgggwahyvgqeklrpqtgwqplafaldwqr
    parhmnstsyfynhssqwryetvtaeellspmadksrytghlidfnvraermgwlpsapq
    lgtnpltiageaekagmnpvdytvkslkegsirfaaeqpengknhprnlfiwrsnllgss
    gkghefmlkyllgtehgiqgkdlgqqggvkpeevdwqdnglegkldlvvtldfrlsstcl
    ysdiilptatwyekddmntsdmhpfihplsaavdpaweaksdweiykaiakkfsevcvgh
    lgketdivtlpiqhdsaaelaqpldvkdwkkgecdlipgktaphimvverdypatyerft
    sigplmekignggkgiawntqsemdllrklnytkaegpakgqpmlntaidaaemiltlap
    etngqvavkawaalseftgrdhthlalnkedekirfrdiqaqprkiissptwsgledehv
    synagytnvhelipwrtlsgrqqlyqdhqwmrdfgesllvyrppidtrsvkevigqksng
    nqekalnfltphqkwgihstysdnllmltlgrggpvvwlseadakdlgiadndwievfns
    ngaltaravvsqrvpagmtmmyhaqerivnlpgseitqqrggihnsvtritpkpthmigg
    yahlaygfnyygtvgsnrdefvvvrkmknidwldgegndqvqesvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r27C (C:)
    rdwedgyrqrwqhdkivrsthgvnctgscswkiyvknglvtwetqqtdyprtrpdlpnhe
    prgcprgasyswylysanrlkypmmrkrlmkmwreakalhsdpveawasiiedadkaksf
    kqargrggfvrsswqevneliaasnvytiknygpdrvagfspipamsmvsyasgarylsl
    iggtclsfydwycdlppaspqtwgeqtdvpesadwynssyiiawgsnvpqtrtpdahfft
    evrykgtktvavtpdyaeiaklcdlwlapkqgtdaamalamghvmlrefhldnpsqyftd
    yvrrytdmpmlvmleerdgyyaagrmlraadlvdalgqennpewktvafntngemvapng
    sigfrwgekgkwnleqrdgktgeetelqlsllgsqdeiaevgfpyfggdgtehfnkvele
    nvllhklpvkrlqladgstalvttvydltlanyglerglndvncatsyddvkaytpawae
    qitgvsrsqiiriarefadnadkthgrsmiivgaglnhwyhldmnyrglinmlifcgcvg
    qsgggwahyvgqeklrpqtgwqplafaldwqrparhmnstsyfynhssqwryetvtaeel
    lspmadksrytghlidfnvraermgwlpsapqlgtnpltiageaekagmnpvdytvkslk
    egsirfaaeqpengknhprnlfiwrsnllgssgkghefmlkyllgtehgiqgkdlgqqgg
    vkpeevdwqdnglegkldlvvtldfrlsstclysdiilptatwyekddmntsdmhpfihp
    lsaavdpaweaksdweiykaiakkfsevcvghlgketdivtlpiqhdsaaelaqpldvkd
    wkkgecdlipgktaphimvverdypatyerftsigplmekignggkgiawntqsemdllr
    klnytkaegpakgqpmlntaidaaemiltlapetngqvavkawaalseftgrdhthlaln
    kedekirfrdiqaqprkiissptwsgledehvsynagytnvhelipwrtlsgrqqlyqdh
    qwmrdfgesllvyrppidtrsvkevigqksngnqekalnfltphqkwgihstysdnllml
    tlgrggpvvwlseadakdlgiadndwievfnsngaltaravvsqrvpagmtmmyhaqeri
    vnlpgseitqqrggihnsvtritpkpthmiggyahlaygfnyygtvgsnrdefvvvrkmk
    nidwldgegndqvqesvk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1r27D (D:)
    mkirsqvgmvlnldkcigchtcsvtcknvwtsregveyawfnnvetkpgqgfptdwenqe
    kykggwirkingklqprmgnramllgkifanphlpgiddyyepfdfdyqnlhtapegsks
    qpiarprslitgermakiekgpnweddlggefdklakdknfdniqkamysqfentfmmyl
    prlcehclnpacvatcpsgaiykreedgivlidqdkcrgwrmcitgcpykkiyfnwksgk
    sekcifcyprieagqptvcsetcvgrirylgvllydadaieraastenekdlyqrqldvf
    ldpndpkvieqaikdgiplsvieaaqqspvykmamewklalplhpeyrtlpmvwyvppls
    piqsaadagelgsngilpdveslripvqylanlltagdtkpvlralkrmlamrhykraet
    vdgkvdtraleevglteaqaqemyrylaianyedrfvvpsshrelareafpekngcgftf
    gdgchgsdtkfnlfnsrridaidvtsktephp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r27D (D:)
    mkirsqvgmvlnldkcigchtcsvtcknvwtsregveyawfnnvetkpgqgfptdwenqe
    kykggwirkingklqprmgnramllgkifanphlpgiddyyepfdfdyqnlhtapegsks
    qpiarprslitgermakiekgpnweddlggefdklakdknfdniqkamysqfentfmmyl
    prlcehclnpacvatcpsgaiykreedgivlidqdkcrgwrmcitgcpykkiyfnwksgk
    sekcifcyprieagqptvcsetcvgrirylgvllydadaieraastenekdlyqrqldvf
    ldpndpkvieqaikdgiplsvieaaqqspvykmamewklalplhpeyrtlpmvwyvppls
    piqsaadagelgsngilpdveslripvqylanlltagdtkpvlralkrmlamrhykraet
    vdgkvdtraleevglteaqaqemyrylaianyedrfvvpsshrel