PDB entry 1r26

View 1r26 on RCSB PDB site
Description: Crystal structure of thioredoxin from Trypanosoma brucei brucei
Class: Electron transport
Keywords: redox-active disulfide; thioredoxin, Electron transport
Deposited on 2003-09-26, released 2003-12-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.169
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin
    Species: Trypanosoma [TaxId:5702]
    Gene: trx
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NG23 (19-End)
      • expression tag (11-18)
    Domains in SCOPe 2.07: d1r26a1, d1r26a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r26A (A:)
    mrgwhhhhhhgirmrarypsvvdvysveqfrnimsediltvawftavwcgpcktierpme
    kiayefptvkfakvdadnnseivskcrvlqlptfiiarsgkmlghviganpgmlrqklrd
    iikdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r26A (A:)
    irmrarypsvvdvysveqfrnimsediltvawftavwcgpcktierpmekiayefptvkf
    akvdadnnseivskcrvlqlptfiiarsgkmlghviganpgmlrqklrdiikd