PDB entry 1r24

View 1r24 on RCSB PDB site
Description: fab from murine igg3 kappa
Deposited on 1998-11-05, released 1999-11-08
The last revision prior to the SCOP 1.59 freeze date was dated 1999-11-08, with a file datestamp of 1999-11-07.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.245
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r24A (A:)
    diqmtqitsslsvslgdrviiscrasqdignflnwyqqkpdgslklliyytsrlqsgvps
    rfsgwgsgtdysltisnleeediatffcqqgktlpytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspiv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r24B (B:)
    dvqlvesggglvqpggsrklscaasgftfsnfgmhwvrqapekglewvayissggssiny
    adtvkgrftisrdnpkntlflqmtslrsedtaiyyctrggtgtrslyyfdywgqgatliv
    ssatttapsvyplvpgcsdtsgssvtlgclvkgyfpgpvtvkwnygalssgvrtvssvlq
    sgfyslsslvtvpsstwpsqtvicnvahpasktdlik
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r24C (C:)
    diqmtqitsslsvslgdrviiscrasqdignflnwyqqkpdgslklliyytsrlqsgvps
    rfsgwgsgtdysltisnleeediatffcqqgktlpytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspiv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r24D (D:)
    dvqlvesggglvqpggsrklscaasgftfsnfgmhwvrqapekglewvayissggssiny
    adtvkgrftisrdnpkntlflqmtslrsedtaiyyctrggtgtrslyyfdywgqgatliv
    ssatttapsvyplvpgcsdtsgssvtlgclvkgyfpgpvtvkwnygalssgvrtvssvlq
    sgfyslsslvtvpsstwpsqtvicnvahpasktdlik