PDB entry 1r1w

View 1r1w on RCSB PDB site
Description: crystal structure of the tyrosine kinase domain of the hepatocyte growth factor receptor c-met
Class: transferase
Keywords: receptor tyrosine kinase, signal transduction, grb2, shc, transferase
Deposited on 2003-09-25, released 2003-10-07
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.174
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatocyte growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: MET
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08581 (Start-311)
      • engineered (145)
      • engineered (223)
    Domains in SCOPe 2.02: d1r1wa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r1wA (A:)
    ntvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihca
    vkslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnf
    irnethnptvkdligfglqvakgmkflaskkfvhrdlaarncmldekftvkvadfglard
    mydkefdsvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvn
    tfditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfigeh
    yvhvnatyvnvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r1wA (A:)
    tvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtllkihcavkslnr
    itdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfirneth
    nptvkdligfglqvakgmkflaskkfvhrdlaarncmldekftvkvadfglardmylpvk
    wmaleslqtqkfttksdvwsfgvllwelmtrgappypditvyllqgrrllqpeycpdply
    evmlkcwhpkaemrpsfselvsrisaifstfigehyvhvnatyvnvk