PDB entry 1r1w

View 1r1w on RCSB PDB site
Description: crystal structure of the tyrosine kinase domain of the hepatocyte growth factor receptor c-met
Deposited on 2003-09-25, released 2003-10-07
The last revision prior to the SCOP 1.71 freeze date was dated 2003-11-11, with a file datestamp of 2003-11-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.174
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1r1wa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r1wA (A:)
    ntvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihca
    vkslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnf
    irnethnptvkdligfglqvakgmkflaskkfvhrdlaarncmldekftvkvadfglard
    mydkefdsvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvn
    tfditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfigeh
    yvhvnatyvnvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r1wA (A:)
    tvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtllkihcavkslnr
    itdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfirneth
    nptvkdligfglqvakgmkflaskkfvhrdlaarncmldekftvkvadfglardmylpvk
    wmaleslqtqkfttksdvwsfgvllwelmtrgappypditvyllqgrrllqpeycpdply
    evmlkcwhpkaemrpsfselvsrisaifstfigehyvhvnatyvnvk