PDB entry 1r1v

View 1r1v on RCSB PDB site
Description: Crystal structure of the metal-sensing transcriptional repressor CzrA from Staphylococcus aureus in the Zn2-form
Class: transcription repressor
Keywords: DNA binding, transcriptional regulation, winged HTH protein, TRANSCRIPTION REPRESSOR
Deposited on 2003-09-25, released 2004-05-18
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.195
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: repressor protein
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: czrA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1r1va_
  • Chain 'B':
    Compound: repressor protein
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: czrA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1r1vb_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r1vA (A:)
    mseqyseintdtlervteifkalgdynririmellsvseasvghishqlnlsqsnvshql
    kllksvhlvkakrqgqsmiyslddihvatmlkqaihhanhpkesgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r1vA (A:)
    ntdtlervteifkalgdynririmellsvseasvghishqlnlsqsnvshqlkllksvhl
    vkakrqgqsmiyslddihvatmlkqaihhanhpke
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r1vB (B:)
    mseqyseintdtlervteifkalgdynririmellsvseasvghishqlnlsqsnvshql
    kllksvhlvkakrqgqsmiyslddihvatmlkqaihhanhpkesgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r1vB (B:)
    ntdtlervteifkalgdynririmellsvseasvghishqlnlsqsnvshqlkllksvhl
    vkakrqgqsmiyslddihvatmlkqaihhanhpkes