PDB entry 1r1p
View 1r1p on RCSB PDB site
Description: Structural Basis for Differential Recognition of Tyrosine Phosphorylated Sites in the Linker for Activation of T cells (LAT) by the Adaptor Protein Gads
Class: peptide binding protein
Keywords: SH2, Gads, phosphopeptide, PEPTIDE BINDING PROTEIN
Deposited on
2003-09-24, released
2004-09-28
The last revision prior to the SCOPe 2.06 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.198
AEROSPACI score: 0.48
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: GRB2-related adaptor protein 2
Species: Mus musculus [TaxId:10090]
Gene: GADS
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d1r1pa_ - Chain 'B':
Compound: GRB2-related adaptor protein 2
Species: Mus musculus [TaxId:10090]
Gene: GADS
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d1r1pb1, d1r1pb2 - Chain 'C':
Compound: GRB2-related adaptor protein 2
Species: Mus musculus [TaxId:10090]
Gene: GADS
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d1r1pc1, d1r1pc2 - Chain 'D':
Compound: GRB2-related adaptor protein 2
Species: Mus musculus [TaxId:10090]
Gene: GADS
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d1r1pd_ - Chain 'E':
Compound: LAT pY171 peptide
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Chain 'F':
Compound: LAT pY171 peptide
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Chain 'G':
Compound: LAT pY171 peptide
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Chain 'H':
Compound: LAT pY171 peptide
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Heterogens: SO4, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>1r1pA (A:)
gsfidiefpewfheglsrhqaenllmgkdigffiirasqsspgdfsisvrheddvqhfkv
mrdtkgnyflwtekfpslnklvdyyrttsiskqkqvflrd
Sequence, based on observed residues (ATOM records): (download)
>1r1pA (A:)
iefpewfheglsrhqaenllmgkdigffiirasqsspgdfsisvrheddvqhfkvmrdtk
gnyflwtekfpslnklvdyyrttsiskqkqvflrd
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1r1pB (B:)
gsfidiefpewfheglsrhqaenllmgkdigffiirasqsspgdfsisvrheddvqhfkv
mrdtkgnyflwtekfpslnklvdyyrttsiskqkqvflrd
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>1r1pC (C:)
gsfidiefpewfheglsrhqaenllmgkdigffiirasqsspgdfsisvrheddvqhfkv
mrdtkgnyflwtekfpslnklvdyyrttsiskqkqvflrd
- Chain 'D':
Sequence, based on SEQRES records: (download)
>1r1pD (D:)
gsfidiefpewfheglsrhqaenllmgkdigffiirasqsspgdfsisvrheddvqhfkv
mrdtkgnyflwtekfpslnklvdyyrttsiskqkqvflrd
Sequence, based on observed residues (ATOM records): (download)
>1r1pD (D:)
iefpewfheglsrhqaenllmgkdigffiirasqsspgdfsisvrheddvqhfkvmrdtk
gnyflwtekfpslnklvdyyrttsiskqkqvflrd
- Chain 'E':
No sequence available.
- Chain 'F':
No sequence available.
- Chain 'G':
No sequence available.
- Chain 'H':
No sequence available.