PDB entry 1r1k

View 1r1k on RCSB PDB site
Description: Crystal structure of the ligand-binding domains of the heterodimer EcR/USP bound to ponasterone A
Class: hormone/growth factor receptor
Keywords: NUCLEAR RECEPTOR, TRANSCRIPTION REGULATION, HETERODIMER, ALPHA-HELICAL SANDWICH, Structural Proteomics in Europe, SPINE, Structural Genomics, hormone/growth factor receptor COMPLEX
Deposited on 2003-09-24, released 2003-11-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.243
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ultraspiracle protein
    Species: Heliothis virescens [TaxId:7102]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r1ka_
  • Chain 'D':
    Compound: Ecdysone receptor
    Species: Heliothis virescens [TaxId:7102]
    Gene: ECR OR NR1H1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r1kd_
  • Heterogens: P1A, EPH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r1kA (A:)
    mvqelsierllemeslvadpseefqflrvgpdsnvppkfrapvsslcqignkqiaalvvw
    ardiphfsqlemedqillikgswnelllfaiawrsmeflteerdgvdgtgnrttsppqlm
    clmpgmtlhrnsalqagvgqifdrvlselslkmrtlrvdqaeyvalkaiillnpdvkglk
    nrqevevlrekmflcldeycrrsrsseegrfaalllrlpalrsislksfehlfffhlvad
    tsiagyirdalrnhappidtnmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r1kA (A:)
    vqelsierllemeslvadpseefqflrvgpdsnvppkfrapvsslcqignkqiaalvvwa
    rdiphfsqlemedqillikgswnelllfaiawrsmeflterttsppqlmclmpgmtlhrn
    salqagvgqifdrvlselslkmrtlrvdqaeyvalkaiillnpdvkglknrqevevlrek
    mflcldeycrrsrsseegrfaalllrlpalrsislksfehlfffhlvadtsiagyirdal
    r
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1r1kD (D:)
    gshmasmtggqqmgrdplknvppltanqksliarlvwyqegyeqpseedlkrvtqtwqsd
    eddedsdmpfrqitemtiltvqlivefakglpgfakisqsdqitllkacssevmmlrvar
    rydaatdsvlfannqaytrdnyrkagmayviedllhfcrcmysmmmdnvhyalltaivif
    sdrpgleqpllveeiqryylntlrvyilnqnsasprcavifgkilgilteirtlgmqnsn
    mcislklknrklppfleeiwdvadva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r1kD (D:)
    vppltanqksliarlvwyqegyeqpseedlkrvtqtwdsdmpfrqitemtiltvqlivef
    akglpgfakisqsdqitllkacssevmmlrvarrydaatdsvlfannqaytrdnyrkagm
    ayviedllhfcrcmysmmmdnvhyalltaivifsdrpgleqpllveeiqryylntlrvyi
    lnqnsasprcavifgkilgilteirtlgmqnsnmcislklknrklppfleeiwdva