PDB entry 1r0p

View 1r0p on RCSB PDB site
Description: crystal structure of the tyrosine kinase domain of the hepatocyte growth factor receptor c-met in complex with the microbial alkaloid k-252a
Deposited on 2003-09-22, released 2003-10-07
The last revision prior to the SCOP 1.69 freeze date was dated 2003-11-04, with a file datestamp of 2003-11-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.171
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1r0pa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r0pA (A:)
    ntvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihca
    vkslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnf
    irnethnptvkdligfglqvakgmkflaskkfvhrdlaarncmldekftvkvadfglard
    mydkefdsvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvn
    tfditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfigeh
    yvhvnatyvnvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r0pA (A:)
    tvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldkihcavksln
    ritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfirnet
    hnptvkdligfglqvakgmkflaskkfvhrdlaarncmldekftvkvadfglardmydke
    fdsvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypitvyllqg
    rrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfigehyvhvnatyvnv
    k