PDB entry 1r0l

View 1r0l on RCSB PDB site
Description: 1-deoxy-D-xylulose 5-phosphate reductoisomerase from zymomonas mobilis in complex with NADPH
Class: oxidoreductase
Keywords: reductoisomerase, NADPH complex, Fosmidomycin, non-mevalonate pathway, zymomonas mobilis, OXIDOREDUCTASE
Deposited on 2003-09-22, released 2004-07-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.249
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1-deoxy-D-xylulose 5-phosphate reductoisomerase
    Species: Zymomonas mobilis [TaxId:542]
    Gene: dxr
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1r0la1, d1r0la2, d1r0la3
  • Chain 'B':
    Compound: 1-deoxy-D-xylulose 5-phosphate reductoisomerase
    Species: Zymomonas mobilis [TaxId:542]
    Gene: dxr
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1r0lb1, d1r0lb2, d1r0lb3
  • Chain 'C':
    Compound: 1-deoxy-D-xylulose 5-phosphate reductoisomerase
    Species: Zymomonas mobilis [TaxId:542]
    Gene: dxr
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1r0lc1, d1r0lc2, d1r0lc3
  • Chain 'D':
    Compound: 1-deoxy-D-xylulose 5-phosphate reductoisomerase
    Species: Zymomonas mobilis [TaxId:542]
    Gene: dxr
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1r0ld1, d1r0ld2, d1r0ld3
  • Heterogens: NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r0lA (A:)
    msqprtvtvlgatgsighstldliernldryqvialtanrnvkdladaakrtnakravia
    dpslyndlkealagssveaaagadalveaammgadwtmaaiigcaglkatlaairkgktv
    alankeslvsagglmidavrehgttllpvdsehnaifqcfphhnrdyvrriiitasggpf
    rttslaematvtperavqhpnwsmgakisidsatmmnkglelieafhlfqiplekfeilv
    hpqsvihsmveyldgsilaqigspdmrtpightlawpkrmetpaesldftklrqmdfeap
    dyerfpaltlamesiksggarpavmnaaneiavaafldkkigfldiakivektldhytpa
    tpssledvfaidneariqaaalmeslpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r0lA (A:)
    qprtvtvlgatgsighstldliernldryqvialtanrnvkdladaakrtnakraviadp
    slyndlkealagssveaaagadalveaammgadwtmaaiigcaglkatlaairkgktval
    ankeslvsagglmidavrehgttllpvdsehnaifqcfphhnrdyvrriiitasggpfrt
    tslaematvtperavqgakisidsatmmnkglelieafhlfqiplekfeilvhpqsvihs
    mveyldgsilaqigspdmrtpightlawpkrmetpaesldftklrqmdfeapdyerfpal
    tlamesiksggarpavmnaaneiavaafldkkigfldiakivektldhytpatpssledv
    faidneariqaaalmesl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r0lB (B:)
    msqprtvtvlgatgsighstldliernldryqvialtanrnvkdladaakrtnakravia
    dpslyndlkealagssveaaagadalveaammgadwtmaaiigcaglkatlaairkgktv
    alankeslvsagglmidavrehgttllpvdsehnaifqcfphhnrdyvrriiitasggpf
    rttslaematvtperavqhpnwsmgakisidsatmmnkglelieafhlfqiplekfeilv
    hpqsvihsmveyldgsilaqigspdmrtpightlawpkrmetpaesldftklrqmdfeap
    dyerfpaltlamesiksggarpavmnaaneiavaafldkkigfldiakivektldhytpa
    tpssledvfaidneariqaaalmeslpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r0lB (B:)
    qprtvtvlgatgsighstldliernldryqvialtanrnvkdladaakrtnakraviadp
    slyndlkealagssveaaagadalveaammgadwtmaaiigcaglkatlaairkgktval
    ankeslvsagglmidavrehgttllpvdsehnaifqcfphhnrdyvrriiitasggpfrt
    tslaematvtperavqhpakisidsatmmnkglelieafhlfqiplekfeilvhpqsvih
    smveyldgsilaqigspdmrtpightlawpkrmetpaesldftklrqmdfeapdyerfpa
    ltlamesiksggarpavmnaaneiavaafldkkigfldiakivektldhytpatpssled
    vfaidneariqaaalmesl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1r0lC (C:)
    msqprtvtvlgatgsighstldliernldryqvialtanrnvkdladaakrtnakravia
    dpslyndlkealagssveaaagadalveaammgadwtmaaiigcaglkatlaairkgktv
    alankeslvsagglmidavrehgttllpvdsehnaifqcfphhnrdyvrriiitasggpf
    rttslaematvtperavqhpnwsmgakisidsatmmnkglelieafhlfqiplekfeilv
    hpqsvihsmveyldgsilaqigspdmrtpightlawpkrmetpaesldftklrqmdfeap
    dyerfpaltlamesiksggarpavmnaaneiavaafldkkigfldiakivektldhytpa
    tpssledvfaidneariqaaalmeslpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r0lC (C:)
    msqprtvtvlgatgsighstldliernldryqvialtanrnvkdladaakrtnakravia
    dpslyndlkealagssveaaagadalveaammgadwtmaaiigcaglkatlaairkgktv
    alankeslvsagglmidavrehgttllpvdsehnaifqcfphhnrdyvrriiitasggpf
    rttslaematvtperavakisidsatmmnkglelieafhlfqiplekfeilvhpqsvihs
    mveyldgsilaqigspdmrtpightlawpkrmetpaesldftklrqmdfeapdyerfpal
    tlamesiksggarpavmnaaneiavaafldkkigfldiakivektldhytpatpssledv
    faidneariqaaalmesl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1r0lD (D:)
    msqprtvtvlgatgsighstldliernldryqvialtanrnvkdladaakrtnakravia
    dpslyndlkealagssveaaagadalveaammgadwtmaaiigcaglkatlaairkgktv
    alankeslvsagglmidavrehgttllpvdsehnaifqcfphhnrdyvrriiitasggpf
    rttslaematvtperavqhpnwsmgakisidsatmmnkglelieafhlfqiplekfeilv
    hpqsvihsmveyldgsilaqigspdmrtpightlawpkrmetpaesldftklrqmdfeap
    dyerfpaltlamesiksggarpavmnaaneiavaafldkkigfldiakivektldhytpa
    tpssledvfaidneariqaaalmeslpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r0lD (D:)
    qprtvtvlgatgsighstldliernldryqvialtanrnvkdladaakrtnakraviadp
    slyndlkealagssveaaagadalveaammgadwtmaaiigcaglkatlaairkgktval
    ankeslvsagglmidavrehgttllpvdsehnaifqcfphhnrdyvrriiitasggpfrt
    tslaematvtperavqhakisidsatmmnkglelieafhlfqiplekfeilvhpqsvihs
    mveyldgsilaqigspdmrtpightlawpkrmetpaesldftklrqmdfeapdyerfpal
    tlamesiksggarpavmnaaneiavaafldkkigfldiakivektldhytpatpssledv
    faidneariqaaalmesl