PDB entry 1r0h

View 1r0h on RCSB PDB site
Description: cobalt-substituted rubredoxin
Class: electron transport
Keywords: rubredoxin, iron-sulfur, Clostridium pasteurianum, ELECTRON TRANSPORT
Deposited on 2003-09-22, released 2004-02-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.147
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubredoxin
    Species: Clostridium pasteurianum [TaxId:1501]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r0ha_
  • Heterogens: CO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r0hA (A:)
    mkkytctvcgyiynpedgdpdngvnpgtdfkdipddwvcplcgvgkdqfeevee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r0hA (A:)
    mkkytctvcgyiynpedgdpdngvnpgtdfkdipddwvcplcgvgkdqfeeve