PDB entry 1r0e

View 1r0e on RCSB PDB site
Description: Glycogen synthase kinase-3 beta in complex with 3-indolyl-4-arylmaleimide inhibitor
Class: transferase
Keywords: Ser/Thr protein kinase, TRANSFERASE
Deposited on 2003-09-20, released 2004-10-12
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.225
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen synthase kinase-3 beta
    Species: Homo sapiens [TaxId:9606]
    Gene: GSK3B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1r0ea_
  • Chain 'B':
    Compound: Glycogen synthase kinase-3 beta
    Species: Homo sapiens [TaxId:9606]
    Gene: GSK3B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1r0eb_
  • Heterogens: FLC, DFN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r0eA (A:)
    gamslskvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlq
    dkrfknrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhysra
    kqtlpviyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvr
    gepnvsyicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlvei
    ikvlgtptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarl
    tpleacahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphariqaaas
    tptnataasdantgdrgqtnnaasasasnst
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r0eA (A:)
    skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfk
    nrelqimrkldhcnivrlryffyssevylnlvldyvpetvyrvarhysrakqtlpviyvk
    lymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsyics
    ryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtptre
    qiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarltpleacahsf
    fdelrdpnvklpngrdtpalfnfttqelssnpplatilipphar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r0eB (B:)
    gamslskvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlq
    dkrfknrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhysra
    kqtlpviyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvr
    gepnvsyicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlvei
    ikvlgtptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarl
    tpleacahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphariqaaas
    tptnataasdantgdrgqtnnaasasasnst
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r0eB (B:)
    skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfk
    nrelqimrkldhcnivrlryffyssevylnlvldyvpetvyrvarhysrakqtlpviyvk
    lymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsyics
    ryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtptre
    qiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarltpleacahsf
    fdelrdpnvklpngrdtpalfnfttqelssnpplatilipphar