PDB entry 1r05
View 1r05 on RCSB PDB site
Description: Solution Structure of Max B-HLH-LZ
Class: transcription
Keywords: Basic-Helix-Loop-Helix-LeucineZipper Homodimer, TRANSCRIPTION
Deposited on
2003-09-19, released
2003-10-21
The last revision prior to the SCOPe 2.07 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: max protein
Species: Homo sapiens [TaxId:9606]
Gene: Max
Database cross-references and differences (RAF-indexed):
- Uniprot P61244 (1-82)
- initiating met (0)
- engineered (57)
- engineered (60)
- cloning artifact (83-86)
Domains in SCOPe 2.07: d1r05a1, d1r05a2 - Chain 'B':
Compound: max protein
Species: Homo sapiens [TaxId:9606]
Gene: Max
Database cross-references and differences (RAF-indexed):
- Uniprot P61244 (1-82)
- initiating met (0)
- engineered (57)
- engineered (60)
- cloning artifact (83-86)
Domains in SCOPe 2.07: d1r05b1, d1r05b2
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1r05A (A:)
madkrahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrkvht
lqqdiddlkrqnalleqqvralegsgc
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1r05B (B:)
madkrahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrkvht
lqqdiddlkrqnalleqqvralegsgc