PDB entry 1qze

View 1qze on RCSB PDB site
Description: HHR23a protein structure based on residual dipolar coupling data
Class: replication
Keywords: DNA repair, proteasome-mediated degradation, protein-protein interaction, replication
Deposited on 2003-09-16, released 2003-10-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uv excision repair protein rad23 homolog a
    Species: Homo sapiens [TaxId:9606]
    Gene: RAD23A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54725 (6-End)
      • cloning artifact (5)
    Domains in SCOPe 2.05: d1qzea1, d1qzea2, d1qzea3, d1qzea4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qzeA (A:)
    gplgssavtitlktlqqqtfkirmepdetvkvlkekieaekgrdafpvagqkliyagkil
    sddvpirdyrideknfvvvmvtktkagqgtsappeasptaapesstsfppaptsgmshpp
    paaredkspseesapttspesvsgsvpssgssgreedaastlvtgseyetmlteimsmgy
    erervvaalrasynnphraveylltgipgspepehgsvqesqvseqpateaagenplefl
    rdqpqfqnmrqviqqnpallpallqqlgqenpqllqqisrhqeqfiqmlneppgeladis
    dvegevgaigeeapqmnyiqvtpqekeaierlkalgfpeslviqayfaceknenlaanfl
    lsqnfdde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qzeA (A:)
    savtitlktlqqqtfkirmepdetvkvlkekieaekgrdafpvagqkliyagkilsddvp
    irdyrideknfvvvmvtgseyetmlteimsmgyerervvaalrasynnphraveylltle
    flrdqpqfqnmrqviqqnpallpallqqlgqenpqllqqisrhqeqfiqmtpqekeaier
    lkalgfpeslviqayfaceknenlaanfllsqnf